KEGG   Dictyoglomus turgidum: Dtur_1789Help
Entry
Dtur_1789         CDS       T00800                                 

Definition
(RefSeq) serine/threonine protein kinase with Chase2 sensor
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dtu  Dictyoglomus turgidum
Brite
KEGG Orthology (KO) [BR:dtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dtu01001]
    Dtur_1789
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dtur_1789
Protein kinases [BR:dtu01001]
 Serine/threonine kinases: Other
  Bacterial family
   Dtur_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase CHASE2 Pkinase_Tyr APH Haspin_kinase Kdo RIO1 Kinase-like Seadorna_VP7 Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 7082968
NCBI-ProteinID: YP_002353675
UniProt: B8E0P1
LinkDB All DBs
Position
complement(1825286..1827286)
Genome map
AA seq 666 aa AA seqDB search
MKRILIKFGLLFIFFVLLLILSNLNFFKVWEKQTIDLRFHLRGEIAPYKDIVIVGIDDNS
ILELGNWPWNRSIHGKLLDVLKRESPKLVVFDILFDTVTPSDVFLAEKVKLSGNVILSGY
LQSYFDKRLKINVMSLKEPVGILKSSALGSGYSNLYIDEDNKVRRVKIYENSGSIKYYSL
SLVAYKFISKQDLSSLVLKLPSDFYINFRGGEGTYKIYSYIDVLRGNFPKNTFKNKIVLI
GAVSPVLKDLFLHPFSGFTSRLGVNYSYMSGVEIHANIIDNLFMHDFFVPIFPGFVFIIN
FLAVFLPGVLFGRRIILNLFLTFLFIFLYFMFSYQAFINKVLLPLVSPSVGLIFSFLGNV
IYLNLIPKERLEGVVIKRRYKILKKLGSGGMASVYLALDRKTEKEVAIKILHPQYAEDKE
VLERFYREIEICKVLDHPYIVKILDHGKENDYVFMVMEFVNGKDLKKIIEERKRIPVSMA
VEIVKKVAEALSYANSKNIVHRDIKPQNIMITKDGKVKLMDFGIARIGGLSTLTQTGMFM
GTPQYASPEQLEGKKVDVRSDIFSLGIVFYEMLTGILPYSEETTISLMLKRYQEDLPDVR
TINPEVPEGIAKIIEKMTARFPEFRYQTLEELLEDLKRGYPLHPYDRKNILSSDTIIKRD
NDKESY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatattaataaagtttgggcttctttttatcttttttgtattgcttcttatc
ttatctaaccttaatttttttaaggtatgggagaagcaaacaatagatcttagatttcat
ttaagaggagaaattgctccctataaagatatagttatagtaggcattgacgataattct
attttggaacttggtaattggccctggaataggagtattcatggtaagcttcttgatgta
ttaaaaagagagagtcctaaacttgttgtttttgatattctttttgatactgttactccc
tccgacgtattcttagctgaaaaagtaaaactatctggtaatgttattctttctggatat
cttcaaagttattttgataagagattaaaaattaatgtgatgtctttaaaggagcctgtt
ggtatcctaaaaagttctgctcttggcagtggctatagtaatttatatattgatgaggat
aacaaggtaagaagggtaaaaatttatgaaaattctggctcaataaaatattactctctt
tctcttgtggcttataaatttataagtaaacaagacttatcatctcttgtcttgaaatta
ccttcggatttctatattaactttaggggaggagagggaacttacaaaatttattcttat
attgatgttttgagaggaaattttccaaaaaatacttttaagaacaagatagttctaata
ggtgctgtaagccctgtattaaaagatcttttcttgcatcccttttcgggattcacctca
agattaggagtaaattattcctatatgtctggagtggaaattcatgcaaatataattgat
aatttgtttatgcatgacttttttgtcccaatttttccgggatttgttttcattataaat
tttcttgcagtatttttgccaggagttctttttggaaggagaattatactgaatcttttc
ttaacttttttgtttattttcctctactttatgttctcttatcaggcttttataaataaa
gttttacttcctttagtttcgccttctgtaggtctgatcttttcatttttaggaaatgta
atttatttgaatttaatacccaaggaaagattagaaggtgtagtaataaagaggaggtat
aaaatacttaagaagcttggatcaggcggaatggcatcagtttatcttgctttagatagg
aaaacagagaaagaagttgctataaaaattcttcatcctcaatatgctgaagataaggag
gtattagagagattttatagagagatagagatctgcaaggttcttgatcatccttatatt
gtgaaaattttggatcatggcaaagaaaatgattatgtctttatggttatggagtttgtt
aatggtaaggatttgaagaagattatagaagagaggaagagaattcctgtttctatggcg
gttgagattgttaaaaaagtagccgaagctctttcttatgctaattcaaaaaatatagta
catagggatataaaaccccagaatattatgattacaaaagatggaaaagtaaagcttatg
gactttgggatagctcgaattggagggctttctacattaacccaaacaggtatgtttatg
ggtactccacagtatgcctctccagagcagttagagggtaaaaaagtagatgtaaggtcg
gatatattttctcttgggattgttttttatgagatgttgacaggaattcttccatattcc
gaagaaactaccatttctcttatgctgaaaagatatcaagaagatttacctgatgtaaga
actataaatcctgaggttcctgaaggaatagcgaaaattattgaaaagatgaccgcgaga
tttcctgaatttagatatcagactctagaagagcttcttgaggatttaaaaagaggatac
cctcttcatccttatgataggaagaatattttatcatctgatactataattaagagggat
aatgacaaagagagttattga

DBGET integrated database retrieval system