KEGG   Dyella thiooxydans: ATSB10_02140Help
Entry
ATSB10_02140      CDS       T04308                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dtx  Dyella thiooxydans
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ATSB10_02140
Enzymes [BR:dtx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ATSB10_02140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO Glutaredoxin AlaDh_PNT_C FAD_binding_3 Thi4 Nif11 K_oxygenase FMO-like NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AND67668
UniProt: A0A160MY29
LinkDB All DBs
Position
complement(232072..233661)
Genome map
AA seq 529 aa AA seqDB search
MLDANLSAQLKAYLEKVTQPIEIVESLDDGAKSAELHELLEEIASLSDRITLVRRDDDAR
KPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKATQDVIEQVKSLDGDFVF
ETYFSQSCQNCPDVVQALNLMSVLNPKIKHIAIDGALFQDEVDARQVMSVPTVYLNGEVF
DQGRMSLEQIVAKLDTGAARRDAEKLKTKDAFDVLIVGGGPAGAAAAIYSARKGIRTGVA
AERFGGQVLDTMGIENLISVPHTEGPKLAAALEQNVREHEVDVMNLQCATRLIPASEATG
GLVQVQLENGAALKSKTVILSTGARWRQMNVPGENDYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVSHVTLLEFDSQLRADEVLQRKLRSLPNVAILVNAQTTEVLGD
GQKVNGLVYTDRVSGNTHTIDLEGIFVQIGLLPNTEWLKGTVELSARGEIVINDRGETSV
PGVFAAGDATTVPYKQIVIAMGAGSTAALSAFDHLMRLPVAAKPEAVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctctccgcccagttgaaggcctacctcgagaaggtcacgcagccg
atcgagatcgtcgagtcgctcgacgacggcgccaagtccgccgagctgcacgagctgctg
gaagaaatcgcctcgctctcggaccggatcaccctggtgcgccgcgacgacgacgcgcgc
aagccgtcctttgcgatcaaccgtgtgggcacggacatcggcgtgcgcttcgccggcatc
ccgatgggccacgaattcacctcgctcgtgctcgcgctgctgcaggtcggcggtcatccg
tccaaggccacgcaggacgtgatcgagcaggtaaagagcctcgacggcgacttcgtcttc
gagacctatttctcgcagtcctgccagaactgcccggacgtggtgcaggcgctcaacctg
atgagcgtgctgaatccgaagatcaagcacattgccatcgacggcgcgctgttccaggac
gaggtggatgcccgccaggtgatgtcggtgcccaccgtctatctcaacggtgaggtgttc
gaccagggccgcatgagcctggaacagatcgtcgccaagctcgacaccggtgccgccagg
cgtgacgccgagaagctcaagaccaaggacgccttcgacgtgctgatcgtcggcggcggc
ccggccggcgcggcggcggcgatctacagcgcgcgcaagggcatccgcaccggcgtcgcc
gccgagcgcttcggcggccaggtgctggacaccatgggcatcgagaacctgatctcggtg
ccgcacaccgaaggcccgaagctcgccgccgcgctggagcagaacgtgcgcgagcacgag
gtcgacgtgatgaacctgcagtgcgcgaccaggctcattcctgccagcgaagccaccggt
ggcctggtccaggtgcagctggagaacggcgccgcgctgaagtccaagaccgtgatcctc
tccaccggcgcgcgctggcggcagatgaacgtgccgggcgagaacgactaccgcaacaag
ggcgtggcctactgcccacactgcgacggcccgctgttcaagggcaagcgcgtggcggtg
atcggcggcggcaactccggcgtggaggcggcgatcgacctggccggcatcgtcagccac
gtcaccctgctcgagttcgacagccagctgcgcgccgacgaagtcctgcagcgcaagctg
cgcagcctgccgaacgtggcgatcctggtgaacgcgcagaccaccgaggtgctgggcgac
ggccagaaggtcaacggactcgtctacaccgaccgcgtcagcggcaacacccacacgatc
gacctggaaggcatcttcgtgcagatcggcctgctgccgaataccgagtggctgaagggc
acggtggaactgtcggcccgcggcgagatcgtcatcaacgaccgcggcgagacctcggta
ccgggcgtgttcgccgccggcgacgccaccacggtaccgtacaagcagatcgtgatcgcc
atgggtgccggctccaccgcggcgctgagcgccttcgaccacctgatgcgtctgccggtg
gcggcgaagccagaagcggtggcggcctga

DBGET integrated database retrieval system