KEGG   Dyella thiooxydans: ATSB10_02720Help
Entry
ATSB10_02720      CDS       T04308                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00250  Alanine, aspartate and glutamate metabolism
dtx00280  Valine, leucine and isoleucine degradation
dtx00410  beta-Alanine metabolism
dtx00640  Propanoate metabolism
dtx00650  Butanoate metabolism
dtx01100  Metabolic pathways
dtx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ATSB10_02720
   00650 Butanoate metabolism
    ATSB10_02720
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ATSB10_02720
   00280 Valine, leucine and isoleucine degradation
    ATSB10_02720
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ATSB10_02720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dtx01007]
    ATSB10_02720
Enzymes [BR:dtx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ATSB10_02720
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ATSB10_02720
Amino acid related enzymes [BR:dtx01007]
 Aminotransferase (transaminase)
  Class III
   ATSB10_02720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AND67726
UniProt: A0A160MX69
LinkDB All DBs
Position
complement(299608..300891)
Genome map
AA seq 427 aa AA seqDB search
MSKNSDWVLRRANALPRGIATAMPICVERASNAELWDVDGRRFIDFAAGIAVLNVGHQHP
RVVEAVQAQMQRFAHTAFQVAAYDVYIELCERLNSLAPIAGKRKSILFSTGAEAVENAIK
IARAATRRHAVIAFHGGFHGRSFMAMALTGKTAPYKRGFGPLSAGVFHAPFPCAHRGISV
ADSLQAIERIFMADVAAEDVAAIIVEPVQGEGGFNPAPDELLQGLRELADRHGILLVADE
VQSGIARTGRLFGMEHSGVQPDLMIVAKSLAAGFPLSAVIGRAEVMDAVDPGGLGGTYAG
SPTACAAALAVLDLVQEQGLAAHAEALGQQVRAFLQGLQGRPDLHPIGHIRGRGSMLAFD
LLQSTGADAVAPEKTREVIRRAHELGLVVLGCGAYGESIRLLYPLTIDEQVLDEGLGLLE
QALKNPG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacagtgattgggtgctgcgccgggccaacgcccttccccggggtatcgcc
acggccatgccgatctgcgtggagcgggcctcgaacgccgagctgtgggacgtcgacggt
cgacgcttcatcgactttgccgcgggcatcgcggtgctgaacgtgggtcaccagcatccg
cgcgtggtggaggcggtgcaggcgcagatgcaacgctttgcgcatactgcgttccaggtg
gcggcgtacgacgtctacatcgaactgtgcgagcgacttaactcgctggcgccgattgcc
ggcaaacgcaagtcgatcctgttttcgaccggcgccgaagcggtggagaacgcgatcaag
atcgcccgcgccgccacccggcggcatgccgtgattgctttccatggcgggttccacggc
cgcagcttcatggccatggcgctgaccggcaagaccgcgccgtacaagcgtggctttggt
ccgttgtctgccggtgttttccatgcgccgttcccctgcgcgcatcgaggcatcagcgtg
gcggacagcctgcaggcgatcgagcgcattttcatggctgacgtggccgccgaggatgtg
gctgccatcatcgtggagccggtgcagggcgagggtgggttcaacccggcgcccgatgaa
ctgctgcagggtttgcgcgaactggcggaccggcacggcatcctgctggtggccgacgag
gtgcagagcggcatcgcccgcaccggacgcctgttcggcatggagcacagcggtgtgcag
ccggacctgatgatcgtggccaagtcgctggcggccgggtttccgctgtccgccgtgatc
ggtcgcgccgaagtgatggacgcggtcgacccgggtggactgggcggtacctatgccggt
tcgcccacggcatgcgccgcggccctggcggtgctcgatcttgtccaagagcaaggcctg
gcagcgcatgccgaagcgctggggcagcaggtgcgggctttccttcaaggcctgcagggg
cggcccgacctgcatccgatcgggcatatccgcggccgtggctcgatgctggccttcgac
ctgttgcagtcgaccggtgccgatgcggtggcgccggagaaaacccgcgaagtgatccgg
cgcgcgcacgagctgggactggtggtgctgggctgcggcgcctacggcgaatcgatccgc
ctgctgtacccgctgaccatcgacgaacaggtactcgacgagggactgggtctgctggag
caggcactgaaaaacccaggctga

DBGET integrated database retrieval system