KEGG   Dyella thiooxydans: ATSB10_06220Help
Entry
ATSB10_06220      CDS       T04308                                 

Definition
(GenBank) glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ATSB10_06220
Enzymes [BR:dtx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ATSB10_06220
Transporters [BR:dtx02000]
 Other Transporters
  Pores ion channels [TC:1]
   ATSB10_06220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_6 DUF1073
Motif
Other DBs
NCBI-ProteinID: AND68076
UniProt: A0A160MXY7
LinkDB All DBs
Position
656545..657153
Genome map
AA seq 202 aa AA seqDB search
MKLYYLPGACSLSPNIVAHELGITLTLDKVDGKTKLTASGENFLEVNPKGYVPAIRLDDG
EVLTEGPAIMQYLADLKPESGLAPPNGTLARYRLQEILTYINSELHKTFSPLFNPATADE
ARAERVEYLKRRYGYIESILSRQPYLMGDHFTVADAYLFVVTHWSRVIKLDLSEFPALLA
FQKRIAERPAVQAAMREEGLVK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacctccccggtgcctgctcgctgtcgcccaacatcgtggcgcacgaa
ctgggcattacgctcacgctggacaaggtggacggcaagaccaagctcaccgcgtcgggc
gagaacttcctcgaggtgaaccccaagggctacgtgccggccatccgcctggacgacggc
gaggtgctcaccgaggggccggcgatcatgcagtacctggcggacctgaagccggagagc
gggctggccccaccgaacggcacgttggcgcgctaccgcctgcaggagatcctcacctac
atcaactccgagctgcacaagaccttcagtccgctgttcaacccggccaccgcggacgag
gcgagggccgagcgcgtcgaatacctcaagcgccgttacggctacatcgagagcatcctt
tcacgtcagccgtacctcatgggtgaccacttcacggtggctgacgcctacctgttcgtg
gtaacccactggtcacgcgtgatcaagctggacctgagcgaatttccggcgttgctggcg
ttccagaagcgcatcgccgagcggcccgccgtgcaggcggcgatgcgtgaggaaggcctg
gtcaagtaa

DBGET integrated database retrieval system