KEGG   Dyella thiooxydans: ATSB10_22920Help
Entry
ATSB10_22920      CDS       T04308                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00473  D-Alanine metabolism
dtx00550  Peptidoglycan biosynthesis
dtx01100  Metabolic pathways
dtx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ATSB10_22920
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ATSB10_22920
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ATSB10_22920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dtx01011]
    ATSB10_22920
Enzymes [BR:dtx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ATSB10_22920
Peptidoglycan biosynthesis and degradation proteins [BR:dtx01011]
 Precursor biosynthesis
  Amino acid ligase
   ATSB10_22920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp CPSase_L_D2 ATP-grasp_3 ATPgrasp_Ter ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AND69746
UniProt: A0A160N1P2
LinkDB All DBs
Position
complement(2441527..2442486)
Genome map
AA seq 319 aa AA seqDB search
MSKITDPAQFGRVAVVMGGSSAEREVSLDSGRNVLAALKARGVDAHAIDGIPALLDALRA
GHFARVFNILHGQHGGGEDGVLQGALESLNVPYTGSGLLGSALSMDKTRSKRVWQSLGLP
TPKFAALPRGADVHVAAREIGFPLIVKPACEGSSVGVTRVFEEKDLDAAVELAARYPGDL
LMETLIEGDELTVAVLGREVLPSIHIVPQGAFYDYNAKYVAEDTRYICPGLQGEAESELR
MLALAAFDALGCSGWGRVDVMRDRAGRNWLLEVNTAPGMTSHSLVPKAAAAAGITYEELC
WRVLETSLDRDRGIPGGRA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcaccgacccggcccagttcggacgcgtcgccgtggtgatgggcggcagc
tcggccgagcgcgaggtgtcgctcgactcgggccgcaacgtgctggctgcgctgaaggcg
cgcggcgtggacgcacacgccatcgacggtatcccggcgctgctggatgccctgcgcgcc
ggccacttcgcgcgtgtgttcaacatcctgcacggccagcacggcggtggcgaggacggc
gtactacagggcgcgctggagtcgctcaacgtgccgtacaccggctcgggcttgctcggc
tcggcgctgtcgatggacaagacgcgctccaagcgggtgtggcagtcgctgggcctgccg
acgccgaagttcgccgccctgccgcgcggcgccgacgtgcacgtggcggcgcgggagatc
ggcttcccgctgatcgtgaagccggcctgcgagggctccagcgtgggcgtgacgcgcgtg
ttcgaggagaaggacctcgacgcggcggtggagcttgcggcgcggtatcccggcgatctg
ctgatggagaccctgatcgagggcgacgaactgaccgtggcggtgctcggccgcgaggtg
ctgccgtcgatccacatcgtcccgcagggcgcgttctatgactacaacgccaaatacgtc
gccgaggacacccgctacatctgccccggcctgcagggtgaggcggagagcgagctgcgc
atgctggcgctggcggcgttcgacgcgctcggctgcagcggctggggccgcgtcgacgtg
atgcgcgaccgcgccggccgcaactggctgctggaggtgaacaccgcgccgggcatgacc
tcgcactcgctggtgccgaaggctgcggccgcggccggtatcacctacgaggaactgtgc
tggcgcgtgctggagaccagcctcgaccgggatcgcggcatccccggagggcgcgcgtga

DBGET integrated database retrieval system