KEGG   Dyella thiooxydans: ATSB10_23280Help
Entry
ATSB10_23280      CDS       T04308                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00620  Pyruvate metabolism
dtx00680  Methane metabolism
dtx01100  Metabolic pathways
dtx01120  Microbial metabolism in diverse environments
dtx01200  Carbon metabolism
Module
dtx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATSB10_23280
  09102 Energy metabolism
   00680 Methane metabolism
    ATSB10_23280
Enzymes [BR:dtx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ATSB10_23280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AND69782
UniProt: A0A160N355
LinkDB All DBs
Position
complement(2492045..2494753)
Genome map
AA seq 902 aa AA seqDB search
MPFQPDTPDLPHDAPLREDVSRIGAMVGQMLAEQRGEAFFEKVEAVRTTAIRRRREDEPV
ALLDRALSGMQAEEAEALARAFATYFQAVNIAERVHRIRRRRDYQRSGNNPQPESLLDVL
TRLKAQGVTAAELVDWLGRLHVEPVFTAHPTEAVRRSLLEKEQAIVRSLVDNFDPTRTPQ
ERKEDDDRIFMALSSGWQTAEASPVQPTVQDEHHHVGFYLANPIYRIVPALYESLADALQ
QVYGIAVPMPRLLSFATWVGGDMDGNPNVGADTIAASLASQRAHVLEHYAQDVAGLARLL
SQTEGRVAVSPELLARLEDYRARFPEAAKKIRPRHADMPYRTLLTLIGARLEATHEDDHP
EGYTSVDELAGDLELIAHSLIDHHGLHAGAYAVQRLVRRVRTFGLHLARLDVRQDSQVHD
DALAALQGDADWGQRSPAERVEKLHPFASGEKELAPVDEENAQRMRAVFQAMGTARRRYG
AEAVGLYIISMARTAADVLAVLALARHGGLAVEGQPVPLDVAPLFETVDDLKNAPATLRA
LLADPVYRAHLASRGGRQWVMLGYSDSGKDGGTLASRWGLQRAQVELLDIANEAGIQLAF
FHGRGGSASRGGARMTPALMSSPRGSVAGVLRVTEQGEVIHRKYGIRALALRNLEQTVGA
VLRASLRPRDEEPREDAWRERMHILSATSRRHYRAFVDREGFVEYFRAATPIDVIERMTL
GSRPSRRRSMRGVQDLRAIPWVFSWTQCRSIITGWYGLGTALEQGAAEFGEEALAEMARD
WPFFSNMLDDVEMVLAKCDLAIAEAFSKLAGELHAPFFALIREEFERTCHWVLRLKGDQA
LLDESPRLAQSIRLRNPYVDPMSVLQIDLLRRWRASDREDEALLRALVACVNGVSQGLQN
TG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgccattccagcccgacacccccgacctgccgcacgacgcccccctgcgcgaggacgtc
agccggatcggcgcgatggtcgggcagatgctcgccgagcagcgcggcgaggcgttcttc
gagaaggtcgaggcggtgcgcaccacggcgatccgccgccgccgcgaggacgaaccggtg
gccctgctggaccgcgcgctgagcggcatgcaggcggaggaggccgaggcgctggcccgc
gccttcgccacctacttccaggcagtcaacatcgccgagcgggtgcatcgcatccgccgc
cgccgcgactaccagcgcagcggcaataacccgcagcccgagtccctgctcgacgtgctg
acccggctcaaggcgcagggcgtcaccgccgccgagctggtcgactggctcggccgcctg
cacgtggagccggtgttcaccgcccatccgaccgaggccgtgcgccgctcgctgctggag
aaggagcaggcgatcgtccgctcgctggtggacaacttcgaccccacccgcaccccgcag
gaacgcaaggaggacgacgaccgcatcttcatggcgctgtcctccggctggcagaccgcc
gaggcctcgccggtgcagcccaccgtgcaggacgagcatcaccacgtcggcttctatctg
gccaacccgatctaccgcatcgtgccggcgctgtacgaatcgctggccgacgcgctgcag
caggtctacggcatcgcggtgccgatgccgcgcctgctcagcttcgccacctgggtcggc
ggcgacatggacggcaaccccaacgtgggcgccgacaccatcgccgccagcctggccagc
cagcgcgcccacgtgctcgagcactacgcgcaggacgtcgccgggctggcccgcctgctc
agccagaccgagggccgcgtggcggtgtcgccggagctgctggcgcgactggaggactac
cgcgcgcgcttcccggaagcggcgaagaagatccgcccgcgccacgccgacatgccctac
cgcaccctgctgaccctgatcggtgcacggctggaggcgacccacgaggatgaccatccg
gaaggctatacgtccgtcgacgaactggccggcgacctggaactgatcgcgcacagcctg
atcgaccaccacggcctgcatgccggtgcctatgcggtgcagcgactggtccgccgtgtg
cgcaccttcggcctgcacctggcccggctcgacgtgcggcaggactcgcaggtgcatgac
gatgccctcgccgcgctgcagggcgacgccgactggggacagcgcagtccggccgagcgg
gtggagaagctgcatccgttcgccagcggtgaaaaggaactggccccggtggacgaggag
aacgcccagcgcatgcgcgcggtgttccaggcgatgggtacggctcgccgccgctacggc
gccgaggcggtcggcctgtacatcatctcgatggcgcgcaccgccgccgacgtgctggcg
gtgctcgcgctggcccgccacggtggcctggccgtggaaggccagccggtgccgctggac
gtggcaccgctgttcgagacggtggacgacctgaagaacgccccggccacgctgcgcgcg
ctgctggccgatccggtctatcgcgcccacctcgcctcgcggggtggccgccagtgggtg
atgctcggctactccgacagcggcaaggacggcggcacgctggcctcgcgctggggtctg
cagcgcgcccaggtggaactgctggacatcgcgaacgaggccggcatccagctcgccttc
ttccatggccgtggcggctcggccagccgcggcggcgcgcgcatgacgccggcgctgatg
tcctcgccgcgcggttcggtcgccggcgtgctgcgcgtcaccgaacagggcgaggtgatc
caccgcaagtacggcatccgcgcgctggcgctgcgcaacctggagcagaccgtcggcgcc
gtgctgcgcgccagcctgcgcccgcgtgacgaagagccgcgcgaggacgcctggcgcgag
cgcatgcacatactctcggcgaccagccgcaggcactaccgcgccttcgtcgaccgagag
ggcttcgtcgaatacttccgcgcggccacgccgatcgacgtgatcgagcggatgaccctg
ggttcgcgcccctcgcgccgtcgcagcatgcgcggcgtgcaggacctgcgcgcgatcccg
tgggtgttctcctggacccagtgccgctcgatcatcaccggctggtacggcctgggcacc
gcgctggagcagggcgcagccgaattcggcgaggaggcgctggccgagatggcgcgcgac
tggccgttcttcagcaacatgctcgacgacgtggagatggtgctggccaagtgcgacctg
gccatcgccgaggcgttctcgaagctggccggcgagctgcacgcgccgttcttcgcgctg
atccgcgaggagttcgaacgcacctgccactgggtgctgcgcctgaagggcgaccaggcg
ctgctcgacgaatcgccgcggctggcccagtcgatccgcctgcgcaacccgtacgtggac
ccgatgagcgtgctgcagatcgacctgctcaggcgctggcgtgccagcgaccgcgaggac
gaggccctgctgcgcgccctcgtggcctgcgtcaacggcgtctcgcaggggctccagaac
accggttga

DBGET integrated database retrieval system