KEGG   Dyella thiooxydans: ATSB10_27980Help
Entry
ATSB10_27980      CDS       T04308                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00061  Fatty acid biosynthesis
dtx01100  Metabolic pathways
dtx01212  Fatty acid metabolism
Module
dtx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ATSB10_27980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dtx01004]
    ATSB10_27980
Enzymes [BR:dtx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ATSB10_27980
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     ATSB10_27980
Lipid biosynthesis proteins [BR:dtx01004]
 Fatty acid synthase
  Component type
   ATSB10_27980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AND70252
UniProt: A0A160N462
LinkDB All DBs
Position
2998398..2998913
Genome map
AA seq 171 aa AA seqDB search
MTRPSEFNRDQLLACARGELFGPGNARLPAPPMLMFDRITHVDDHGGAYGKGVLRAELDI
HPELWFFGCHFAGDPVMPGCLGLDAMWQLSGFFLPWLGEPGRGRALGVGQVKFSGQVLPD
ARLVRYEIDVRRVMRGRLALVVADGKTFVDDRLIYVASDMRVGLFQSTEGF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcccctccgagttcaaccgcgaccagttgctggcctgcgcccgcggcgagctg
ttcggccccggcaacgcacgcctgcccgccccgccgatgctgatgttcgaccgcatcacc
cacgtcgacgaccacggcggcgcctacggcaagggcgtgctgcgcgccgagctggacatc
catccggagctctggttcttcggctgccatttcgccggcgatccggtgatgcccggctgc
ctgggactggacgcgatgtggcagctgtcggggttcttcctgccgtggctgggcgagccc
ggacgcggacgcgcgctcggcgtagggcaggtgaaattcagcggccaggtgctgccggat
gcgcggctggtgcgctacgagatcgacgtgcgccgggtgatgcgcggcaggctcgcgctg
gtggtggccgacggcaagaccttcgtcgacgaccgcctgatctacgtcgccagcgacatg
cgggtgggcctgttccagtccacggagggcttctga

DBGET integrated database retrieval system