KEGG   Dyella thiooxydans: ATSB10_32230Help
Entry
ATSB10_32230      CDS       T04308                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00010  Glycolysis / Gluconeogenesis
dtx00620  Pyruvate metabolism
dtx01100  Metabolic pathways
dtx01110  Biosynthesis of secondary metabolites
dtx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATSB10_32230
   00620 Pyruvate metabolism
    ATSB10_32230
Enzymes [BR:dtx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ATSB10_32230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AND70677
UniProt: A0A160N4B4
LinkDB All DBs
Position
complement(3497691..3499211)
Genome map
AA seq 506 aa AA seqDB search
MTKLEQQHLAVQVPFKQRYDNFIGGQWVAPKAGRYFENITPITGKAFCEIARSDASDIEA
AIDAAHAAKTAWGRTPVAERALILNRIADRMEQNLALLAHAETWDNGKPIRETIAADLPL
AIDHFRYFAGCIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVWAELVGDLLPAGVLNIVNGFGLEAGKPLASNPRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFDDVAREDDDFFDKALEGFTMFALNQGEV
CTCPSRALVQESIFDRFMERAVKRVQAIKLGNPLDPSTMIGAQASGEQMEKILSYIDIGR
QEGAKVLTGGARAEHGGELKEGYYVQPTVFHGHNKMRVFQEEIFGPVVSVTTFKNEAEAL
EIANDTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HRMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctcgaacagcaacacctcgccgtgcaggtccccttcaagcagcgctacgac
aacttcatcggcggccagtgggtcgcgcccaaggccgggcgctatttcgagaacatcacg
ccgatcaccggcaaggcgttctgcgagatcgcccgctccgacgcctcggacatcgaggcc
gcgatcgatgccgcacacgccgccaaaaccgcctggggtcgcaccccggtggccgagcgt
gcgctgatcctcaaccgcatcgccgaccgcatggagcagaacctcgccctgctcgcccac
gccgagacctgggacaacggcaagccgatccgcgagaccatagccgccgacctgccgctg
gcgatcgaccacttccgctacttcgccggctgcatccgcgcgcaggaaggcagcatcggc
gagatcgaccacgacaccgtcgcctaccacttccacgaaccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccgcgtggaaactcgccccggcgctggcc
gccggcaactgcgtggtgctcaagccggccgagcagaccccggccagcatcctggtgtgg
gccgagctggtcggcgacctgctgccggccggcgtgctcaacatcgtcaacggcttcggc
ctggaagccggcaagccgctggcgtccaacccgcgcatcgccaagatcgccttcaccggc
gagaccaccaccggccggctgatcatgcagtacgccagccagaacctgatcccggtgacg
ctggagctgggcggcaagtcgccgaacatcttcttcgacgacgtggcgcgcgaggacgac
gacttcttcgacaaggcgctggaaggcttcaccatgttcgcgctcaaccagggcgaggta
tgcacctgcccgagccgcgcactggtgcaggagtcgatcttcgaccgcttcatggagcgc
gcggtcaagcgcgtgcaggcgatcaagctgggcaacccgctcgacccgtcgacgatgatc
ggcgcgcaggcctccggcgagcagatggagaagatcctgtcctacatcgacatcggtcgg
caggaaggcgccaaggtgctcaccggcggcgcgcgcgccgagcacggcggcgagctgaag
gagggctactacgtgcagcccaccgtgttccacggccacaacaagatgcgcgtgttccag
gaagagatcttcggcccggtggtctcggtcaccaccttcaagaacgaggccgaggcgctg
gagatcgccaacgacacgctgtacggcctgggcgccggcgtgtggagccgcgacgccaac
cgctgctaccgcttcggtcgcgagatccaggccggccgcgtgtggaccaactgctaccac
gcctaccccgcgcacgcggcgttcggcggctacaagcaatccggcatcggtcgcgagacg
caccggatgatgctcgaccactaccagcagaccaagaacatgctggtgagctactcgccg
aagaagctcggcttcttctga

DBGET integrated database retrieval system