KEGG   Dyella thiooxydans: ATSB10_37170Help
Entry
ATSB10_37170      CDS       T04308                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dtx01100  Metabolic pathways
dtx01110  Biosynthesis of secondary metabolites
dtx01130  Biosynthesis of antibiotics
dtx01230  Biosynthesis of amino acids
Module
dtx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ATSB10_37170
Enzymes [BR:dtx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ATSB10_37170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_16 AAA_22 ABC_tran Cytidylate_kin2 AAA_5 SRP54 Cytidylate_kin AAA AAA_24 AAA_28 AAA_23 AAA_17
Motif
Other DBs
NCBI-ProteinID: AND71171
UniProt: A0A160N4Z4
LinkDB All DBs
Position
complement(4059315..4059854)
Genome map
AA seq 179 aa AA seqDB search
MNPSCNLFIVGPTGAGKTSIGRRLAEHYQLAFVDLDHEIERHCGVPVSTVFELEGEAGFR
RRESEMLDQCTQPQGIVLATGAGAVLDPVNRQRLAARGYVLWLQAGIEQQLERLARDTKR
PLLAGEDRRAKLAAMREAREPLYRELADLVLPDEHESVHAATQRAIALIDNHWNRTRAA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtcgtgcaacctgttcatcgtcggaccgaccggagccggcaagacctcgatc
ggccggcgcctcgccgaacactaccagctcgccttcgtcgacctcgaccacgagatcgag
cgccactgcggcgtgccggtgagcacggtgttcgagctggaaggcgaggccggcttccgc
cggcgcgagagcgagatgctcgaccagtgcacgcagccgcaaggcatcgtgctggccacc
ggcgccggcgcggtgctcgatccggtcaatcgccagcgcctggccgcacgcggctacgtg
ctgtggctgcaagccggcatcgagcagcagctcgaacgactggcccgcgacaccaagcgc
ccgctgctggccggcgaggatcgccgcgcgaaacttgccgcgatgcgcgaggcgcgcgaa
ccgctgtaccgcgaactggccgacctggtgctgccggacgagcacgaaagcgtgcacgcg
gccacccaacgcgccatcgccctgatcgacaaccactggaaccgcacccgagccgcatga

DBGET integrated database retrieval system