KEGG   Dehalococcoides sp. UCH007: UCH007_07870Help
Entry
UCH007_07870      CDS       T03880                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
duc  Dehalococcoides sp. UCH007
Brite
Enzymes [BR:duc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UCH007_07870 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAQ34745
UniProt: A0A0C6EIY0
LinkDB All DBs
Position
758596..759174
Genome map
AA seq 192 aa AA seqDB search
MYTARDYSYLIGLEGFSDTLLRNHFTLYQGYVNNTNKLSDTLKTMLTEGKTATPEYAELK
RRFGFEYNGMRLHEYYFSNLSTSAPLSESNKLYQAISAEFGSYQLWEADFKATAAMRGIG
WVVLYKDSQTGRLFNQWINEHETGHLAGLSPILVIDVFEHAFITDYGLKRADYIYAFIKN
TNWAEAENRFKA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagcccgtgattattcgtacctgataggtctcgaaggattttctgatacactc
cttagaaatcactttaccctatatcagggttatgtaaacaacactaataaactttcagat
accttaaaaactatgctcaccgagggtaaaacagctactccagaatatgccgaactcaaa
cgccgatttgggtttgagtataacggtatgcgtctgcacgagtattacttttctaatctg
agtacttctgcacccttatccgaatcaaacaaactttaccaggcaatatcagcagagttt
ggcagctaccagctctgggaagcagactttaaggctactgccgcaatgcggggaataggc
tgggtagtactctataaagattcccagacagggcggctttttaaccaatggataaacgaa
catgagaccgggcatctggcaggtttgtctccgatattggtcatagacgtatttgaacat
gcctttattacagattacggtttgaaacgagcagattatatttacgccttcattaagaac
acaaactgggctgaagcggaaaaccgctttaaggcataa

DBGET integrated database retrieval system