KEGG   Dehalococcoides sp. UCH007: UCH007_10380Help
Entry
UCH007_10380      CDS       T03880                                 

Definition
(GenBank) hypothetical protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
duc  Dehalococcoides sp. UCH007
Pathway
duc00061  Fatty acid biosynthesis
duc00780  Biotin metabolism
duc01100  Metabolic pathways
duc01130  Biosynthesis of antibiotics
duc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:duc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    UCH007_10380
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    UCH007_10380
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    UCH007_10380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:duc01004]
    UCH007_10380
Enzymes [BR:duc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     UCH007_10380
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     UCH007_10380
Lipid biosynthesis proteins [BR:duc01004]
 Fatty acid synthase
  Component type
   UCH007_10380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase NTase_sub_bind CCDC158
Motif
Other DBs
NCBI-ProteinID: BAQ34996
UniProt: A0A0C6EES6
LinkDB All DBs
Position
1014849..1015688
Genome map
AA seq 279 aa AA seqDB search
MTQTSYGLLKGKKGIIFGPLNEQSLGWKIALACHREGAKLAISNVATALKMGNTAELARI
CGQAPLLVADATSDDELKALFAELKTSLGEIDFIVHSVGMSANIRKKIPYESTNYIFYNK
GLEISAISLHKIIRYALEAGVLKDNGSILALSYIGAQRVFSQYNDMNDAKALLEAIARNF
GSRLADRGIRVNTVSQSPTRTSAGSGISNFDAMYEYANLLAPLGNASGEECADYVVTLLS
DLSRKVTMQNLFHDGGFSSAGISEKLLSLLERNQPEAGV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacgtcttacggattgctcaagggtaaaaaaggaattatattcggcccctta
aacgagcaaagtctgggctggaaaatagccctggcctgccaccgcgaaggagctaaactg
gctatttccaacgtagctaccgcccttaaaatgggaaacaccgccgaactggcccgcatt
tgcggccaagccccgctgctggttgcagatgccaccagcgatgatgagctgaaagccctg
tttgccgaactgaaaaccagcctgggggagatagatttcatagtccattcggtaggtatg
agcgccaatatccgcaagaaaataccgtatgaatctaccaactatattttttataacaaa
gggctggaaatttcggccatatccctgcacaaaataatccgttatgcacttgaagccgga
gtcctcaaagacaacggcagcatactggcgttgtcgtatataggggcgcaaagggtattt
tcccagtataacgacatgaacgatgccaaagccctgctggaagctattgcccgaaatttc
ggttcccgcctggcagaccggggaataagggtaaataccgtttcccagtcacctacccgc
acctccgccggttcgggaataagcaattttgatgccatgtacgaatatgcaaatctgctt
gcccccttgggtaatgccagcggggaagaatgcgctgattatgtggtaaccctgctttca
gacctcagccgcaaggttaccatgcaaaaccttttccatgacggggggttttccagtgca
ggtatttccgaaaaactgcttagtttgctggaacgcaatcagccagaagcgggtgtataa

DBGET integrated database retrieval system