KEGG   Duganella sp. AF9R3: HH213_10120Help
Entry
HH213_10120       CDS       T06560                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dug  Duganella sp. AF9R3
Brite
KEGG Orthology (KO) [BR:dug00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HH213_10120 (ahpF)
Enzymes [BR:dug01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HH213_10120 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 DAO HI0933_like FAD_oxidored FAD_binding_3 Glutaredoxin NAD_binding_8 Thi4 AlaDh_PNT_C K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QJD90407
LinkDB All DBs
Position
complement(2213329..2214927)
Genome map
AA seq 532 aa AA seqDB search
MLDATLKTQLKAYLEKVVYPLELVASLDDSAKAREMKELLLEISELSDKITLVERTEAGV
RAPSFSINRAGTDIAVRFAAIPMGHEFTSLVLALLQVGGHTIKFDEAVIEQIRNLDGDYE
FETFMSLTCHNCPDVVQALNAMSVINPRIKVTTIDGGLFAKEVEERQILAVPMMFLNGQH
FGQGRTSVEEILAKLDTNAGVRQAAELSKKDVFDVLIVGGGPAGAAAAVYAARKGIRTGV
LAERFGGQVLDTLAIENFISVKETDGPKFAVALEQHVREYEVDIMNTQRANKLVQVGKLT
EIHTASGAVLKAKSVILSTGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVSVIGG
GNSGVEAAIDLAGLVKHVTLIEFGAELRADAVLQRKLRSLPNVTVITSAQTTEIHGDGKI
VNGLSYTDRNTSVSHKVELEGVFVQIGLVPNTEWLKGTVALSRHGEIEVDARGQTSLPGV
FAAGDVTTVPYKQIIIATGEGAKAALSAFDHLIRSDDEEVVEESADKHAMTA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgctaccctcaaaacccagttaaaagcctacctggaaaaagtggtttatcca
ctggagctggtcgcctctctcgatgacagcgccaaagcccgcgagatgaaagaactgctc
ctcgaaatttccgagttgagcgacaaaatcacgctggtcgagcgcaccgaggcgggcgtg
cgcgcaccgtcgttcagcatcaaccgtgccggtaccgatatcgccgtgcgtttcgccgcg
attccgatgggccacgaattcacctcgctggtgctggcgctgctgcaagtcggcggccac
accatcaaatttgacgaagccgtgatcgagcagatccgcaacctggatggcgattacgaa
ttcgaaaccttcatgtcgctgacctgccataactgcccggacgtggtgcaggcgctgaac
gccatgtcggtgattaacccgcgcatcaaagtcaccaccatcgacggcggcctgttcgcc
aaggaagtggaagagcgccagatcctggccgtgccgatgatgttcctgaacggccagcat
ttcggccagggccgtacttcggtcgaggaaatcctcgccaagctggacaccaatgccggc
gtccgccaggcagctgaactgagcaagaaagacgtgttcgacgtgctgatcgtcggcggt
ggccctgccggcgccgcagcggccgtgtacgccgcccgcaaaggcatccgtaccggtgta
ctggccgagcgtttcggcggccaggtgctggacacgctggcgatcgagaactttatctcg
gtcaaggaaaccgacggcccgaaatttgccgtggcgctggagcagcacgtccgcgaatat
gaagtcgacatcatgaatacccagcgcgccaacaagctggtgcaggtcggcaaactgacc
gaaatacacaccgcctccggcgccgtgctgaaagccaagtcggtgatcttgtcgaccggc
gcccgctggcgtgagatcaacgtgccgggcgagaaggaataccgcaaccacggtgtggcc
tactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtgtcggtgatcggcggc
ggtaactccggcgtggaagcggcgatcgacttggccggcctggtcaagcacgtgacgctg
atcgagttcggcgccgaactgcgcgccgacgcggtgctgcaacgcaagctgcgcagcctg
ccgaatgtcaccgtgatcacctcggcgcaaaccaccgagatccacggcgacggcaagatc
gtcaacggcctgagctacaccgaccgcaacaccagcgtgtcgcacaaggtcgagctggaa
ggcgtattcgtgcagatcggcctggtgccgaataccgagtggctgaaaggcacggtagcc
ctgtcgcgtcatggcgagatcgaagtcgatgcgcgtggccagacctcgctgccgggtgtg
tttgccgccggcgacgtcaccaccgtgccgtacaagcagatcatcatcgccaccggcgaa
ggcgcgaaagcggcactgtcggccttcgatcacctgatccgctcggacgacgaggaagtc
gtcgaagagtcggccgacaagcacgcgatgaccgcgtaa

DBGET integrated database retrieval system