KEGG   Dermabacter vaginalis: DAD186_20230Help
Entry
DAD186_20230      CDS       T04434                                 

Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
dva  Dermabacter vaginalis
Pathway
dva00561  Glycerolipid metabolism
dva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    DAD186_20230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dva04147]
    DAD186_20230
Enzymes [BR:dva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DAD186_20230
Exosome [BR:dva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DAD186_20230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ANP28573
UniProt: A0A1B0ZKX1
LinkDB All DBs
Position
complement(2256792..2258342)
Genome map
AA seq 516 aa AA seqDB search
MPETSDQKYILAIDQGTTSSRAMVFDHDGHAVSQAQLEHKQIFPRSGWVEHDPMEIWSNT
REVIALALNRAEVNRDDLAAVGITNQRETAVVWDKNTGKPVYNAIVWQDTRTARIVHELA
GEEGVNRFKEVTGLPLTTYFAGPKVKWILDHVEGAREKAEAGDLLFGTIDTWLLWHMTGA
TKGGAHVTDVTNASRTLLMNVHTLEWDEDIAREMGIPMSMLPEIRSSSEVYGKGRKRGLL
TNVPIAGILGDQQAATFGQACFEKGTAKNTYGTGNFLLVNTGNEALSSDNGLLTTVLYKL
GDADPVYALEGSVAVTGSLVQWIRDSIGLISSAKEVEELATKVDDSGGCFVVPAFSGLFA
PYWKDDARGAIVGLTRYVNKHHIARAVLEATAYQSAELIDAMNEDAKVPLKELRVDGGMT
VNETLMQFQADILGVDVIRPKIIETTALGAAYAAGLAVGFWNSTDDLEKYWDEDVRWTPS
MDAHVRERSMRLWRKAVERTFDWVDDDVEAAFDHEG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccagagacctcagaccagaaatacattctcgccatcgaccagggcacaaccagctcg
cgcgcgatggtgttcgaccacgacggccacgcggtgtcgcaggcccagctcgagcataag
caaatcttcccgcgctcagggtgggtcgagcatgatccgatggagatctggagcaacacc
cgtgaggtcatcgcgctcgcactgaacagggctgaagtgaaccgggatgacctggcagcc
gtcggcattaccaaccagcgcgagaccgctgtcgtgtgggataaaaacaccggcaagccc
gtctataacgcgatcgtgtggcaagacacgcgcacggcgcgaatcgtgcacgagctcgcg
ggcgaggagggcgtgaaccgattcaaagaggtcaccggcctgccgctcacgacgtatttc
gcgggcccgaaggtcaagtggattctcgatcacgtcgagggcgcgcgcgagaaggccgag
gcgggtgacctgctcttcggcacgatcgacacgtggcttttgtggcacatgacgggcgca
acgaagggcggcgcgcacgtcaccgacgtcacgaatgcctcgcgaaccctcctcatgaac
gtgcacacgctcgaatgggacgaggacattgcgcgcgagatgggaatccccatgtcgatg
ctccccgagatccgctcgtcgtccgaggtatacgggaagggccgcaagcgcggcctgctc
acgaacgtgccgatcgcgggcatcctcggcgaccagcaggcggccacgttcggccaggca
tgctttgagaagggcaccgcgaagaacacgtacggcacgggaaacttcctccttgtgaac
accgggaacgaggcactttcctcggataacggtctgctcacgaccgtgctctacaagctt
ggcgacgccgatcccgtctatgcactcgaaggctcggttgccgtcacgggctcgctcgtg
cagtggatccgcgacagcatcggcctgatctcgagcgcgaaagaggtcgaagaactcgca
acaaaggtcgacgattcgggcggctgcttcgtcgtgcccgcgttctcgggcctgttcgcc
ccttactggaaggacgatgctcgcggggcgatcgtgggcctcacccgctacgtcaacaag
catcacattgcgcgtgccgttctcgaggccacggcctaccagagcgccgagttgatcgac
gcgatgaatgaggatgccaaggtgccgctcaaggagctgcgcgttgacggcggcatgacc
gtgaatgagaccctcatgcagttccaggccgacatcctcggcgtggacgtgattcgcccg
aagatcatcgagacaacggcgctcggcgccgcgtatgcggcgggccttgccgtgggcttc
tggaattccaccgacgacctcgagaaatattgggacgaggacgtgcgctggaccccgtcg
atggacgcacacgtgcgcgagcgcagcatgcgcctgtggcgcaaggccgtcgagcgcacg
tttgactgggtcgatgacgacgttgaggcggccttcgaccacgaaggttaa

DBGET integrated database retrieval system