KEGG   Dermabacter vaginalis: DAD186_20240Help
Entry
DAD186_20240      CDS       T04434                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dva  Dermabacter vaginalis
Pathway
dva00564  Glycerophospholipid metabolism
dva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DAD186_20240
Enzymes [BR:dva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DAD186_20240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored NAD_binding_8 AlaDh_PNT_C Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: ANP28574
UniProt: A0A1B0ZKN1
LinkDB All DBs
Position
complement(2258414..2260141)
Genome map
AA seq 575 aa AA seqDB search
MSSSARSALNPSSRAAHLEKLAATSANNPLDIFIVGGGVNGAGAAFDAATRGLSVGIVEM
NDWASGTSSRSSKLMHGGLRYLQMLDFTLVAEALRERDLLISKTAPHLVKPISFMFPMKN
VFERGFIGSGIALYDAMQIGHREVPIHKHVFSKGLAKDFAGLDPEKNSGAIEFYDSRMDD
ARFVAMLVRSAVNLGAAAANYTKVTRYLKDGGRVVGAAITDLETGNEYEVYAREVILAGG
VWTGEEQDRAGADSGLQVLASKGIHITVPREAIEAKDNTGIITQTEKSVLFIIPWDEYWL
IGTTDTPWKENVSVPTATSSDIDYVLEKANDVLRRPLTREDVIGVYAGLRPLLQPVKKSD
GASTKVSREHTVMEVEPGLSAIAGGKYTTYRVMAEDVVDFALRGTPDAPKTKTRDIPVIG
GAGYEEMRVRATALAGKYGIDEVRLERLLFRYGSLLEDIFALMDENPELATPLTDAPRYL
RAEIVYAARSEGVLHLADALMRRTRLDYETRDRGVSAAREVAEILAGELGWDEARREAEI
EAYSAFIAARLEAEHTTSDAEAAALLENVREIPAR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcatccgcccgctccgcactcaatcccagctcgcgtgccgcacaccttgagaaa
cttgccgcgacgagcgccaacaatcccctcgacatcttcatcgtcggcggcggagtcaac
ggtgccggtgccgcctttgatgcggcaacccgcggcctcagcgttggcatcgtcgagatg
aacgactgggcgagtggcacgagctcgcgctcgtccaaactcatgcacggcggcctccgc
tacctgcaaatgctcgatttcacgctcgtcgccgaagccctccgcgagcgcgacctgctc
atctcaaagaccgcgccgcacctggtgaagcccatcagcttcatgttccccatgaagaac
gttttcgagcgcggcttcattggctcgggcatcgccctctacgacgcgatgcagatcggc
caccgcgaggtcccgatccacaagcacgtcttttcgaagggcctcgcgaaggatttcgcg
ggactcgaccccgaaaagaactcgggcgcgatcgagttctacgattcccgcatggatgac
gcgcgcttcgtcgcgatgctcgtgcgctccgccgtgaacctcggcgctgccgccgcgaac
tatacgaaggtcacgcgctacctcaaggacggtggccgcgtcgtgggcgctgccatcacg
gacctcgagacgggtaacgagtacgaggtgtacgcgcgcgaggtcattcttgccggtggc
gtgtggaccggtgaagaacaggatcgcgccggcgccgattcaggccttcaggtgcttgcc
tcgaaaggcatccacatcacggtgccgcgcgaggcgattgaggcgaaggacaacacgggc
atcatcacgcaaaccgagaaatcggtgctgttcatcatcccgtgggacgaatactggctg
atcggcacgaccgacaccccgtggaaagaaaacgtctcggtgcccaccgcaacgagcagc
gacatcgactacgtgctcgaaaaggccaacgacgtgcttcgccgcccgctcacgcgcgag
gacgtcatcggcgtctacgccggcttgcgcccccttcttcagcccgtgaaaaagtctgac
ggcgcctcgacgaaggtgtcgcgcgaacacacggtgatggaggtcgaaccgggcctgagc
gcgatcgccggcggcaagtacacgacctaccgcgtcatggcggaagacgtcgtcgacttc
gcccttcgcgggacccccgatgccccgaagaccaaaactcgcgacatccccgtcatcggt
ggcgccggctacgaggagatgcgggtgcgtgcaaccgcgctcgcggggaagtacggaatc
gacgaggtacgcctcgaacgcttgctcttccgctacggctcattgctcgaggacattttc
gccctcatggacgagaaccccgagctcgcgacaccgctcacggacgcccctcgctatctc
cgtgccgaaattgtgtacgccgcccggagcgagggcgtgcttcacctcgccgatgccctc
atgcgccgcacgcgcctcgactacgagacgcgtgatcgtggcgtgagcgctgctcgcgag
gtcgcggagatcctcgcgggcgagctcggctgggacgaggcgcggcgcgaggccgagatc
gaggcgtactcggcgtttatcgccgcccgcctcgaggcggagcacacgacgagcgatgcc
gaagccgctgccctcctcgagaacgtgcgcgagattcccgcgcgctaa

DBGET integrated database retrieval system