KEGG   Desulfovibrio vulgaris RCH1: Deval_0756Help
Entry
Deval_0756        CDS       T02064                                 

Definition
(GenBank) arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00220  Arginine biosynthesis
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01130  Biosynthesis of antibiotics
dvg01210  2-Oxocarboxylic acid metabolism
dvg01230  Biosynthesis of amino acids
Module
dvg_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:dvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Deval_0756
Enzymes [BR:dvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Deval_0756
    2.3.1.35  glutamate N-acetyltransferase
     Deval_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: ADP85920
UniProt: A0A0E0T046
LinkDB All DBs
Position
complement(916149..917330)
Genome map
AA seq 393 aa AA seqDB search
MSASPKGFRFATVSAGFRKEARPDLALIVSDTPATAAGVFTTNRFQAAPVVVARENLSAR
PVARAVVINSGQANACTGDEGMTNCRTTLDLVGKACGIPAAEVLPASTGVIGAQLHMDKW
REAAPRLAAALGQNTHHDFARAIMTTDAFPKVAERELAIAGTTVRLVGMAKGAGMICPNM
ATMLSVVLCDAAVTPEAWQRLFLDAVDRTFNRVTVDGDTSTNDTVFGLANGASGVTVEGE
DLAKLGEALTDVLARLAYMLVQDGEGATKVMRVKVSGAVDDAEAEAVARTVGHSQLVKTA
MYGRDANWGRIVAAVGRSGASFKAEDVVVTLCGVELFRNGQPTDLDFDTLLREPLKGRDV
TVDIELGAGTGHYELLASDLTHDYVNCNADYRS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatcacccaagggtttccgcttcgccacggtatccgcaggctttcgcaaggaa
gcccgccccgacctcgccctcatcgtcagcgacacgcccgccacggcggcaggcgtcttc
accaccaatcggtttcaggcagccccagtggtcgtggcgcgtgagaatctctccgcacgc
cccgtcgcgcgcgccgttgtcatcaactccggtcaggccaacgcctgcaccggcgacgag
ggcatgaccaactgccgcaccaccctcgacctcgtgggcaaggcatgtggcatccccgcc
gcagaagtgcttccggcatcaacgggcgtcatcggtgcgcagctgcacatggacaagtgg
cgcgaggccgcgccgcgtcttgcagccgccctcgggcagaacacccaccacgacttcgcc
cgtgccatcatgaccaccgacgccttccccaaggtcgccgaacgcgaacttgccatcgcc
ggtaccacggtgcgtctcgtgggcatggccaagggggcgggcatgatatgccccaacatg
gcgaccatgctctctgtcgtgctgtgtgacgccgccgtcaccccggaagcatggcagagg
ctgttcctcgacgcggtggaccgtaccttcaaccgtgtcaccgtcgacggcgacaccagc
accaacgacacggtcttcggccttgccaacggtgccagcggagtcaccgtcgaaggcgaa
gaccttgccaaactcggcgaggcgctgaccgacgttctcgcccgactcgcctacatgctg
gtgcaggatggtgaaggtgccaccaaggtcatgcgcgtgaaggtctccggcgcggtcgac
gacgcagaggccgaagctgtggcgcgcacggtcggtcattcgcaactggtcaagacggcc
atgtacgggcgcgatgccaactggggccgcatcgtggccgccgtaggtcgttccggcgcc
tccttcaaggctgaagacgtggtggtgaccctgtgcggtgttgaactcttccgcaacgga
caacccaccgacctcgacttcgacacgctgctgcgcgaaccactcaagggacgcgacgtc
accgtagacatcgaactcggcgcagggacggggcactacgaacttctcgcctccgacctg
acgcacgactacgtgaactgcaacgccgactaccgttcgtag

DBGET integrated database retrieval system