KEGG   Desulfovibrio vulgaris RCH1: Deval_1088Help
Entry
Deval_1088        CDS       T02064                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00030  Pentose phosphate pathway
dvg01100  Metabolic pathways
dvg01120  Microbial metabolism in diverse environments
dvg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Deval_1088
Enzymes [BR:dvg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Deval_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N DUF448
Motif
Other DBs
NCBI-ProteinID: ADP86249
UniProt: A0A0E0T1D5
LinkDB All DBs
Position
1272694..1274424
Genome map
AA seq 576 aa AA seqDB search
MPRILRINTRERSWRFEEPGKYAGLGGRSLTSRLVQDEVPADTHALSAENRIVAAIGLLS
GTGAANSGRISIGAKSPLTGGIKESNSGGSFCQKLARLDILALVLEDKPEPNAPLVNIVL
TKDGVRFDEAGDMAGKGTYACMDAVSERYGKKACAMLIGPAGESLLTGASIQFSDPWGRP
ARAAGRGGLGAVMGSKRVKAIVIDDEGGTRFGYADEARFKAASKRWAEILRAHPVTGQGL
PGFGTAILVNIINEAGAFPTQNFRTGRCEHAPKISGEVMAEYMEKRGGKVKEGCHAGCII
QCSQNYVDPAGEYITSGFEYETVWAFGGNSLIADIDDIARLDRMCDDLGVDTIEIGNTVA
IAMDAGIIPWGDGKAALKLLARIADPSDALGRIIGSGVGFAAQAFGIDRVPTVKNQSMPA
YDPRAAKGVGVTYATTTMGADHTAGYAICQNMLKVGGDVNPLGKEGQVETSKALQVATAT
VDSLGLCLFVAFAVLDTPDAVQCICDMVSARHGIDFTPNDFIAIGTDVLKVEQKFNADAG
FTPEDDQLPAFMKREPLPPHNVVWDFSVEELQQAKV
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggatactacgtatcaatacaagggagcgtagctggaggttcgaagaaccggga
aagtacgcaggacttggggggcgctctctcacttcgcgccttgttcaggacgaggttcca
gcggatacgcatgcgctgagcgcagagaacaggatcgtggctgccatcggcctgttgtcc
ggcacaggtgcggcgaactccggtcgtatttccatcggggccaagtcgcctctcaccggc
ggcatcaaggagagcaactccggcggttcgttctgccagaagcttgcccgactcgacatt
ctcgccctcgtgcttgaagacaagcccgaacccaatgcacctctggtcaacatcgtcctg
acgaaggatggcgtgcgcttcgatgaggcgggagacatggccggaaagggcacctatgcc
tgcatggatgccgtatcggaacgctacggcaagaaggcttgcgccatgctcatcggccct
gccggcgagtcgcttctcaccggcgcctccatccagttctccgacccgtggggacgtccc
gcccgtgcggcagggcgtggcgggcttggtgccgtcatggggtcgaagcgtgtgaaggcc
atcgtaatcgatgacgaaggcggtacgcgcttcggatacgccgatgaagcccgcttcaag
gccgcttcgaagcgctgggccgagatcctgcgcgcccaccctgtcacggggcagggcttg
cccggcttcgggacggccatcctcgtgaacatcatcaacgaggcgggtgcgttccccacc
cagaacttccgtaccggtcgctgtgagcatgcccccaagatcagcggcgaagtcatggcc
gagtacatggagaagcgtggtggcaaggtcaaggaaggctgccacgccgggtgcatcatc
cagtgttcccagaactatgtcgacccggctggcgagtacatcacctccggtttcgaatac
gagacggtgtgggccttcgggggcaactccctgattgccgacatcgatgacatcgcgcgg
ctggacaggatgtgcgacgacctcggtgtcgacaccatcgagataggcaacaccgttgcc
atcgccatggacgcgggcatcatcccgtggggcgacggcaaggcggcattgaagctgctt
gcccgcatcgcagacccctccgacgccctcggccgcatcatcggttcgggtgtcggtttc
gcggcgcaggccttcggcatcgaccgggtccccaccgtgaagaaccagtccatgcccgcc
tacgacccccgtgcagccaagggtgttggcgtgacctatgccaccaccaccatgggggcc
gaccacacggctggctacgccatctgccagaacatgctcaaggtcggcggtgacgtgaac
ccgctaggcaaggaagggcaggtcgaaacctcgaaggccctgcaggtcgccacggctacc
gtcgactcgctgggtctgtgcctgttcgttgcgttcgcggtgctcgacacccccgatgcc
gtgcagtgcatctgcgacatggtctcggcgcgccacggtatagacttcactccgaacgac
ttcatcgccatcggtaccgatgttctcaaggtggagcagaagttcaatgccgatgcaggg
ttcactcccgaagacgaccaactgcccgcgttcatgaagcgcgaacccctgcctccgcac
aatgtcgtgtgggacttctcggtggaggagttgcagcaggccaaggtctaa

DBGET integrated database retrieval system