KEGG   Desulfovibrio vulgaris RCH1: Deval_1422Help
Entry
Deval_1422        CDS       T02064                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00970  Aminoacyl-tRNA biosynthesis
dvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Deval_1422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dvg03029]
    Deval_1422
Enzymes [BR:dvg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Deval_1422
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Deval_1422
Mitochondrial biogenesis [BR:dvg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Deval_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADP86578
UniProt: A0A0E0T241
LinkDB All DBs
Position
1625311..1626741
Genome map
AA seq 476 aa AA seqDB search
MASYEAVIGLEVHAQLRTRSKLFCSCSTAFGADPNAHVCEVCAGMPGVLPVLNEKAVEFA
ARMGIAVGCTVNRTSVFARKNYFYPDLPKGYQISQYEQPICEHGHLDISVGDAVKRIGIT
RIHLEDDAGKNIHSAGENVSYVDLNRTGVPLIEIVSEPDLRSAEEAVAYLKALRAIVVHL
GICDGNMEEGSFRCDANVSLRPRGAAEFGTRAELKNLNSFRHVQRAIEYEISRQADLLDD
GDKVVQETRLYDSVKNITVSMRGKEEAHDYRYFPDPDLIPIHIDEARLAEWQATLPELPQ
ARLERFMSSFGLSAQDAEVLTAERDHAEFFEAAVKLYDQPRKIANMMLGPLQRELNQRGT
SLAVSAMRPEALAELVRIIDAGLISAKIGNDVFGELFENGAMPEAFVRERGLVQISDTSA
IEQAVDEVIAENPAEVEAYRGGKTKLVSFFVGQVMRKTRGKANPALVNELLASKLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgtacgaagccgtcatcggtcttgaagtccacgcccagttgcgtacccggtcg
aagctgttctgttcgtgttcgacggccttcggggccgaccccaacgcccatgtctgcgag
gtgtgcgccggtatgcccggtgtgctgcccgtgctcaacgagaaggccgtggagttcgcc
gcacgtatggggattgccgtggggtgcaccgtgaatcgcacctcggtcttcgcccgcaag
aactacttctatcccgacctgcccaaggggtatcagatttcgcagtacgagcagcccatc
tgcgagcatgggcatctcgacatctccgtgggcgacgcggtgaagcgcatcggcatcacg
cgcatccatctcgaggacgacgcgggcaagaacatccactccgcaggcgagaacgtgagc
tacgtcgacctcaaccgtacaggggttccgctcatcgaaatcgtgagcgaacccgacctg
cgaagtgcggaggaggcggtggcctatctcaaggccctgcgtgccatcgtggtgcatctt
ggcatctgcgacggcaacatggaggagggcagcttcaggtgcgacgccaacgtgtcgttg
cgtccgcgtggtgccgccgagttcggtacacgcgccgaactgaagaacctgaactcgttc
aggcatgtgcagcgtgccatcgagtacgagatatcccgtcaggccgacctgctggacgat
ggcgacaaggtcgtgcaggagacgcgcctgtacgacagcgtcaagaacatcaccgtctcc
atgcgtggcaaggaagaggcgcacgactaccgctacttccccgaccccgacctcatcccc
atccacatcgacgaggcgcgtctggccgaatggcaggccacgttgcccgaactgccgcag
gcacggcttgagcggttcatgtcgtcgttcggcctttcggcgcaggatgccgaggtgctc
acggcggaacgtgaccacgccgagttcttcgaggccgccgtgaagctgtacgaccagccc
cgcaagatcgccaacatgatgctcgggccgttgcagcgtgaactcaatcagcgcggcacc
tcgctcgccgtctctgccatgcgtcccgaggcacttgccgaacttgtgcgcatcatcgat
gcggggctcatcagtgccaagataggcaacgacgtgttcggcgaactgttcgagaacggt
gccatgccggaagcgttcgtgcgtgagcgcggtcttgtgcagatttccgatacgtcggcc
atcgaacaggcggtggatgaggtcatcgccgagaatcctgccgaagtcgaagcctacagg
ggcggcaagaccaaactcgtgagcttcttcgtggggcaggtcatgcgcaagacgcgcggc
aaggccaatcctgcgctcgtcaacgaacttcttgcttccaagcttggctag

DBGET integrated database retrieval system