KEGG   Desulfovibrio vulgaris RCH1: Deval_2176Help
Entry
Deval_2176        CDS       T02064                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00500  Starch and sucrose metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deval_2176
Enzymes [BR:dvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Deval_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glycos_transf_1 DUF3416 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ADP87320
UniProt: A0A0E0T441
LinkDB All DBs
Position
2446151..2448718
Genome map
AA seq 855 aa AA seqDB search
MQPLKVFSVVPKLPEGLEGLWELAYNLWFSWNEEIAALFSQIDQQLWIESYRNPVWFLNH
VPQRALETLAQDALYKSRLREAVARQRQYLSRPAYTLKGDEGGEGIRVVYFSLEYGISLC
LPIYSGGLGILAGDHLKSASDLNVPLAAIGIAYQQGYFRQYMTPDGWQQERYPNYDFEQM
PMRPALTPDGQPAVVHLDIGDRPLKARIWRVDVGRVPLYLLDTNIAENPPDFRQITERLY
GGNNEMRLWQEMLIGIGGIKALQVLGISPKVIHMNEGHSAFAGLERVRLFMKEHGLSFEA
AVEVAAAGSIFTTHTPVPAGNDRFAPDLMARYFEPYASDMGLAFKVFMALGREVPHDDSE
PFCMPVLALRLSRFNNGVSKLHGRVSRNMWKRVWNQFPVEDVPIGALTNGVHAPTWVAPD
IGLLYDRYLGSNWREDPDSSRAWSLVDTISDAELWRTHERLRARLVDFARMRLHRQLAAQ
GARRQDIQMAEEVLNPEALTIGFARRFATYKRANLLLQERDRLIRLVTSTDRPVQFIFAG
KAHPQDQEGKQLMKELIALCRSRECRMSMVFLEDYDMEVASHLVSGCDIWLNNPRRPLEA
CGTSGMKAMLNGVMQFSTLDGWWDEAYRPDNSLGWAIGKGEEYEDPDYQDFVEVQTLYNI
LENDIIPDFYDRGHGGIPRTWVRRMKAALRELAPAFNSHRMVMDYAGTAYAPALHNFNEL
TQRDFAPARELSEWRMDIMTKWSMLQIRNVRAQQADTLHVGDALTVEAEILLNGIDPGHI
RAEIYAGHLNQDNSFAHRELSPMQHVGQTDDGWQVFRGTTAPAEAGRYGFTVRVCPTHPR
LADPHSLGLIRWAGV
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgcagccactcaaggtgttcagcgtcgtcccgaagctccccgaaggtctcgaaggtctg
tgggaactcgcctacaacctctggttctcatggaacgaggagattgcggcactcttctcg
caaatcgaccagcaactctggatagagagctaccgcaacccggtgtggtttctgaaccat
gtcccgcagagggcccttgagacgctggcacaggacgccctctacaagtcccgcctgcgt
gaggccgtggcacggcagcggcagtatctttcgcgtcccgcatacaccctcaagggtgat
gaagggggcgaaggcatccgcgtcgtctacttcagcctcgaatacggcatctcgctctgc
cttcccatctattcgggcggactcggcattctcgctggcgaccacctcaagtcggccagc
gacctcaacgtcccccttgccgccatcggcatcgcctaccagcagggctacttccggcag
tacatgacgcccgacggctggcagcaggaacgctaccccaactacgacttcgaacagatg
cccatgcgccccgccctcacccccgacgggcagcccgccgtggtgcacctcgacatcggc
gaccgcccgctcaaggcccgcatatggcgcgtggacgtggggcgtgtgccactttacctg
ctcgacaccaatatcgccgagaacccgccggacttccggcaaatcaccgaacgcctgtac
ggtggcaacaacgagatgcgcctctggcaggagatgctcatcggcatcggcggcatcaag
gcgttgcaggtgctcggcatctcgcccaaggtcatccacatgaacgaaggacactcggcc
ttcgccggtcttgagcgcgtccgcctgttcatgaaggagcacggactctcgttcgaggcc
gccgtcgaggtcgccgccgcgggttccatcttcaccacccacaccccggtgcccgcaggg
aacgaccgtttcgcccccgacctcatggcccgctatttcgaaccgtacgccagcgacatg
gggctcgccttcaaggtgttcatggcactgggccgcgaggtgccgcatgacgacagcgaa
ccgttctgcatgcccgtgctggccctgcgcctgtcacggttcaacaatggcgtctccaaa
ctgcacgggcgcgtgtcgcgcaacatgtggaagcgcgtgtggaaccagttccccgtcgag
gatgtgcccataggagccctcaccaacggtgtgcacgcccccacatgggtggccccggac
atcggcctgctctatgacaggtaccttggctcgaactggcgcgaagaccccgacagcagc
cgcgcgtggagccttgtcgataccatctccgatgcggaactctggcgcacccatgagcgg
ctgcgcgcccgcctcgtcgacttcgcccgcatgagactgcacaggcagctggcggcacag
ggggcacgcaggcaggacatccagatggccgaagaggtgctgaaccccgaggccctcacc
atcggcttcgcgcggcggttcgccacctacaagcgcgccaacctgctgttgcaggaacgt
gacaggctcatacgccttgtcaccagcaccgaccgtccggtgcagttcatattcgcgggc
aaggcccatccgcaggaccaggaaggcaaacaactcatgaaggagctcatcgcgctgtgc
cgcagccgcgaatgccgcatgagcatggtctttctggaagactacgacatggaggtggcc
tcgcacctcgtctccggctgcgacatctggctcaacaacccgcgccgcccgctcgaggcc
tgcggcaccagcggcatgaaggccatgctcaacggcgtcatgcagttttcgacactcgat
ggctggtgggacgaggcatacagacccgacaacagcctcggctgggccatcggcaaggga
gaggaatacgaagaccccgactatcaggacttcgtcgaggtgcagacgctctacaacatc
ctcgagaacgacatcatccccgacttctacgaccgcgggcacggcggcattccgcgcaca
tgggtacggcgcatgaaggctgccctgcgtgaactggccccggccttcaactcgcaccgc
atggtcatggactatgccggcaccgcctatgccccggccctgcacaacttcaatgaactg
acgcagcgcgacttcgccccggcacgcgaactctccgaatggcgcatggacatcatgacc
aagtggagcatgctgcagatacgcaacgtccgcgcacagcaggccgataccctgcacgtg
ggcgacgccctcaccgtggaagcggagatactcctgaacggcatcgaccccgggcacatc
cgggccgagatttacgccggacatctcaatcaggacaacagcttcgcccatcgtgaactc
agcccgatgcagcacgtgggacagaccgacgacggctggcaggtcttccggggcactacg
gccccggccgaggcgggccgctacgggttcaccgtgcgtgtgtgccccacgcatccccgg
ctggccgacccgcactcgctgggcctcatccgctgggcgggggtctag

DBGET integrated database retrieval system