KEGG   Desulfovibrio vulgaris RCH1: Deval_2361Help
Entry
Deval_2361        CDS       T02064                                 

Definition
(GenBank) hypothetical protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00061  Fatty acid biosynthesis
dvg00780  Biotin metabolism
dvg01100  Metabolic pathways
dvg01212  Fatty acid metabolism
Module
dvg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Deval_2361
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Deval_2361
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dvg01004]
    Deval_2361
Enzymes [BR:dvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Deval_2361
Lipid biosynthesis proteins [BR:dvg01004]
 Fatty acid synthase
  Component type
   Deval_2361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ADP87505
UniProt: A0A0E0T4L5
LinkDB All DBs
Position
2675970..2676356
Genome map
AA seq 128 aa AA seqDB search
MKTVHEGTFLFPATHPLFADHFEGAPVVPGSLLLRAFVEEAGTVWPDFATQGATGFRFRR
FVTPGRHPFRMERTDLTVRCTLMDAQGGILVRGDLTTADATGDAGTDNDRTGADGEAALH
TSPRGTTA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccgtccacgaaggaacgttcctctttcccgccacccatccgctcttcgcagac
cacttcgaaggtgcgcccgtggtgcccggttcgttgctgcttcgcgccttcgtggaggaa
gcgggcaccgtatggcccgactttgcgacgcagggcgccacgggctttcgtttccggcgg
ttcgtgacgccgggtcgtcacccgtttcgcatggaacgtaccgacctcactgtgcgctgt
acactcatggacgctcaggggggcatactggtgcgaggcgatctgacgacggcagacgcg
acgggcgatgccggaacggataacgacagaacgggcgctgacggagaggcggccctgcat
acctcgccaagaggaacaacggcatga

DBGET integrated database retrieval system