KEGG   Desulfovibrio vulgaris RCH1: Deval_2466Help
Entry
Deval_2466        CDS       T02064                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00020  Citrate cycle (TCA cycle)
dvg00190  Oxidative phosphorylation
dvg00650  Butanoate metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01120  Microbial metabolism in diverse environments
dvg01130  Biosynthesis of antibiotics
dvg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deval_2466
   00650 Butanoate metabolism
    Deval_2466
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Deval_2466
Enzymes [BR:dvg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Deval_2466
    1.3.5.4  fumarate reductase (quinol)
     Deval_2466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_9 Fer4_10 Fer2_4 Fer2 Fer4_4 Fer4 Fer4_21 Fer4_2 Fer4_7 Fer4_17 Fer4_18 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ADP87609
UniProt: A0A0E0T5A0
LinkDB All DBs
Position
2788866..2789585
Genome map
AA seq 239 aa AA seqDB search
MPDTPVTFKVFRCAPGGEASRFDTFEVAVPGHASVLDALDAIRVDIDPTLVYRHSCHHSS
CGTCAMRINGRDRLACITPAHEAAAESSVQGTVTLEPLRGLPLQGDLMVDMRAFYRHFDE
HWSTLRPSEGRAQAALPAGIERFTRLENCIECGCCVSACPVTGTETGDGTSFAGPAVLAA
VRREMGRGPDVPEGLAALAFGPHGEQHCQRHLACSRACPNGVYPARAIMDLRRMRERKE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaccccggtaaccttcaaggtcttccgttgcgcccccggtggcgaagcctca
cgtttcgacaccttcgaggtcgccgtccccggtcacgcctccgtgcttgacgcactagac
gccatccgcgtggatatcgaccccacgctcgtctaccgccactcatgccaccactccagt
tgcgggacatgtgccatgcgcatcaacgggcgcgaccgtcttgcctgcataaccccggcc
cacgaagccgcagcggagtcgtccgtgcaaggcacggtcacgctggaacccttgcggggc
ctccccctgcaaggcgacctcatggtggacatgcgcgccttctataggcacttcgacgag
cactggagcaccctgcgtccttcagaaggacgggcacaggctgccttgcccgccggaatc
gagcggttcacgcgtcttgagaactgcatcgaatgtggttgctgtgtctcggcctgccct
gtcaccggcacagagaccggcgacggaacgtctttcgccgggcctgccgtactcgccgcc
gtgcgcagggaaatggggcgcgggccggatgtgcccgagggactggcggcccttgccttc
ggcccccatggtgaacagcactgccagcggcatctcgcctgcagcagggcctgtcccaac
ggcgtctatcccgcacgcgccatcatggacttgcggcgcatgcgggaacgcaaggaatga

DBGET integrated database retrieval system