KEGG   Desulfovibrio vulgaris RCH1: Deval_2696Help
Entry
Deval_2696        CDS       T02064                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dvg  Desulfovibrio vulgaris RCH1
Brite
KEGG Orthology (KO) [BR:dvg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dvg03012]
    Deval_2696
   03029 Mitochondrial biogenesis [BR:dvg03029]
    Deval_2696
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dvg04147]
    Deval_2696
Translation factors [BR:dvg03012]
 Eukaryotic Type
  Elongation factors
   Deval_2696
 Prokaryotic Type
   Deval_2696
Mitochondrial biogenesis [BR:dvg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Deval_2696
Exosome [BR:dvg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Deval_2696
  Exosomal proteins of breast cancer cells
   Deval_2696
  Exosomal proteins of colorectal cancer cells
   Deval_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ADP87838
UniProt: A0A0E0T5R5
LinkDB All DBs
Position
3022637..3023830
Genome map
AA seq 397 aa AA seqDB search
MGKEKFERKKPHVNIGTIGHIDHGKTTLTAAITKTAGLLGQGKFIAYDEIDKAPEEKERG
ITIATAHVEYETATRHYAHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVELEVRELLTSYGFPGDDVPVVRGSALKALE
SDDPNSDACKPIRELLAACDSYIPEPQRDIDKPFLMPIEDVFSISGRGTVVTGRVERGVI
KVGEEVEIVGIKDTTKSTCTGVEMFRKLLDQGQAGDNIGALLRGVKRDDVERGQVLAAPK
SITPHRKFKAEVYVLSKEEGGRHTPFFSGYRPQFYFRTTDITGVITLEEGVEMVMPGDNA
TFNVELIAPIAMELGLRFAIREGGRTVGAGVVSEIVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggaaaaatttgaacgcaagaagccgcacgtcaatatcggcaccatcggtcac
atcgaccatggtaagaccactctgacggcagccatcaccaagaccgcaggcctcctcggt
cagggcaagttcatcgcgtacgacgaaatcgacaaggctcctgaagaaaaggaacgtggc
atcaccattgccaccgcccacgtcgagtacgagaccgctacgcgtcactacgcgcacgtc
gactgccccggtcacgccgactacatcaagaacatgatcaccggtgcggcccagatggac
ggtgccatcatcgtcgtcgccgccaccgacggtcccatgccccagacccgtgagcacatc
ctgctcgcccgtcaggtcggcgtgccctacatcgtcgtgttcctgaacaagtgcgacatg
gtcgatgacgaagagcttctcgaactcgttgaactcgaagttcgcgaacttctcaccagc
tacggcttccccggcgacgacgttccggtcgtgcgcggctccgccctcaaggctctcgag
tccgacgatcccaactctgacgcctgcaagcccatccgcgagctgctcgccgcttgcgac
agctacatccccgagcctcagcgcgacatcgacaagcccttcctgatgcccatcgaagac
gtgttctcgatctccggccgcggtaccgttgttaccggtcgtgtcgagcgcggtgtcatc
aaggtcggtgaagaagtcgaaatcgtcggcatcaaggacaccaccaagtcgacctgcacc
ggcgtcgaaatgttccgcaagctgctcgatcagggtcaggctggcgacaacatcggtgcc
ctgctccgtggcgtgaagcgtgacgacgtggaacgcggccaggttcttgccgctcccaag
tccatcactccccaccgcaagttcaaggctgaagtgtacgtcctttccaaggaagaaggc
ggtcgtcacactccgttcttctcgggttaccgtccccagttctacttccgtaccacggac
atcactggtgtgatcacccttgaagaaggcgtcgagatggtgatgcccggcgataacgcc
accttcaacgtggaactcatcgcccccatcgccatggaactcggtctccgcttcgctatc
cgcgaaggtggccgtaccgtcggcgcaggcgtggtttccgagatcgtggagtaa

DBGET integrated database retrieval system