KEGG   Drosophila virilis: 6624183
Entry
6624183           CDS       T01066                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dvi  Drosophila virilis
Pathway
dvi04214  Apoptosis - fly
dvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6624183
   04215 Apoptosis - multiple species
    6624183
SSDB
Motif
Pfam: TFIIA Hydin_ADK Presenilin
Other DBs
NCBI-GeneID: 6624183
NCBI-ProteinID: XP_032290268
FlyBase: FBgn0198653
LinkDB
Position
Unknown
AA seq 150 aa
MAIAYFIPDQAQLLARSRQQSAQQAAGSVGSRPANPRQNESRQQQQHRQQQQQQRQRQHR
AGNTQFRANISVPLGREQGAMSMSEFGCWELLAQIFCYALRLYSYNPAQRRPTVIQISFE
ISSNTSDADANIEDADGVGDVTDATAKRRE
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcaattgcttactttatacccgatcaggcgcaactgttggccagaagcaggcaacaa
agtgcgcaacaagctgcaggcagcgtcggctcccgtccagcgaatcccaggcagaacgag
tcccgacaacagcagcagcatcggcagcaacaacaacaacaacgacaacgacaacatcgc
gccggcaatacacaatttcgcgccaacatatcggtgccgctgggacgcgaacagggtgcc
atgtccatgtcggagttcggctgctgggagctgttggcccaaatcttttgctatgccttg
cgcctctacagctacaatcccgcacagcgcaggccgacggtcattcaaatctcgtttgag
atcagcagcaacacaagcgatgcagatgcaaatatagaagatgcagatggagttggagat
gtgactgatgcgactgcgaagcgacgggagtag

DBGET integrated database retrieval system