KEGG   Drosophila virilis: 6624201
Entry
6624201           CDS       T01066                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
dvi  Drosophila virilis
Pathway
dvi04214  Apoptosis - fly
dvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6624201
   04215 Apoptosis - multiple species
    6624201
SSDB
Motif
Pfam: MtrG
Other DBs
NCBI-GeneID: 6624201
NCBI-ProteinID: XP_002048362
FlyBase: FBgn0198651
UniProt: B4LHX9
LinkDB
Position
Unknown
AA seq 67 aa
MAVAFYIPDQAAMLRKAREQEKQLLRLRQWQMATVMLNTIRQLMDSTAGQCLQRAGRKCG
KWRKPSQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggccgtggccttctatatacccgatcaggcggcaatgctgcgcaaggctcgcgaacag
gagaagcaactgttgcgcctacgccagtggcagatggcgaccgtaatgctaaacaccata
cgccagctaatggactccacggccggccagtgtctgcagcgtgcgggtcgcaagtgcggc
aagtggcgcaaaccatcgcagtga

DBGET integrated database retrieval system