KEGG   Drosophila virilis: 6626077
Entry
6626077           CDS       T01066                                 

Definition
(RefSeq) caspase-1 isoform X2
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dvi  Drosophila virilis
Pathway
dvi04214  Apoptosis - fly
dvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6626077
   04215 Apoptosis - multiple species
    6626077
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dvi01002]
    6626077
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6626077
Peptidases and inhibitors [BR:dvi01002]
 Cysteine peptidases
  Family C14: caspase family
   6626077
SSDB
Motif
Pfam: Peptidase_C14 DUF4347
Other DBs
NCBI-GeneID: 6626077
NCBI-ProteinID: XP_002050793
FlyBase: FBgn0209459
UniProt: B4LLW3
LinkDB
Position
Unknown
AA seq 314 aa
MTDECKIRSFGSHSGKINNDADSTDAQGEAGARGGSASNAVAAPTVNKYVARMPTDRYAG
EYNMNHKHRGLALIFNHEFFNIPSLKARAGTNVDCEELRKALKRLDFDVTVHKDCKLGDI
LEHIRNAAAQDHSDNDCIAIAILSHGEHGYLYANDVQYKLDNIWHYLTANNCPTLAGKPK
LFFIQACQGDRLDSGVTLEKNVTETDGDSSTSYKIPIHADFLFSYSTIPGYYSWRNTEKG
SWFIQALIQELNENGKVYSMLKLLTFVSQRVAVDFESNVPSTPIMDRQKQIPCVTSMLTR
ILRFTDKHPTSQAG
NT seq 945 nt   +upstreamnt  +downstreamnt
atgacggacgaatgcaaaataagaagctttggttcacacagcggcaaaataaacaacgat
gcagatagcacagatgcacaaggagaggcgggcgcaagaggtggcagtgcatccaacgca
gtcgcggcgccaaccgttaacaagtatgtagcccgtatgcccaccgatcgctatgccgga
gagtataatatgaatcacaagcaccgcggactggcattgattttcaatcatgaattcttt
aatataccctcgctgaaggcacgtgccggcacaaatgtggactgcgaggaactgcgcaag
gctctgaaacgtctggatttcgatgtgactgtgcacaaggattgcaagctgggcgacata
ctcgagcatatcagaaatgctgccgcgcaggatcacagcgacaacgattgcatagccatt
gccatattgtcgcatggcgaacatggctacctctatgcaaatgatgtgcagtacaagctg
gacaatatatggcattatttgaccgccaacaattgccccacgttggctggtaaaccgaaa
ttgtttttcatacaggcctgtcagggcgacagattggattcgggcgtaacgctggaaaag
aacgtaacggagacggatggtgattcgtcaacgagctacaaaatacccatacatgccgat
tttctattctcatattcaacgattccaggatactattcctggcgcaacactgaaaagggc
tcatggttcatacaggcgctcatccaagagctaaacgaaaacggcaaagtctacagtatg
ctgaaattgctcacttttgttagccaacgtgtggctgtggattttgagtcgaacgtgcca
tctactccgatcatggatcgtcagaagcaaataccgtgtgtgacgtcaatgctaactcgc
attctgcgctttacggacaaacaccctactagccaggcaggctag

DBGET integrated database retrieval system