KEGG   Drosophila virilis: 6626313
Entry
6626313           CDS       T01066                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X1
  KO
K20017  Bcl-2 family protein
Organism
dvi  Drosophila virilis
Pathway
dvi04214  Apoptosis - fly
dvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6626313
   04215 Apoptosis - multiple species
    6626313
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6626313
NCBI-ProteinID: XP_002049520
FlyBase: FBgn0208752
UniProt: B4LKJ2
LinkDB
Position
Unknown
AA seq 298 aa
MPGTSFPTNNDNFSNGFPMISTQAERLLQAQNRRKFSFPATLHSAALLEVGQRETTRRRL
SNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRS
ILGNSNTTIGIVRDVFPAVQVLGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTTNSLNPLEWTTLVIGVVFGLILLFMFFRFIVNTLIPKIYQRFTS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgccaggcacctcattcccaacgaataacgacaatttcagcaacggcttccccatgatc
agcacacaggcggaacgtctgcttcaggcccagaatcgacgcaaattcagttttccggcc
acgcttcactcagcggcgctgctcgaggtgggtcagcgggaaacgacccgcaggcgtctg
agcaatgtcagcgatgtggttacccgcaagctgtcctatacaattggctggaaagcggct
caaatacctgcccaggacataatcacacagggacgctgcttgtgtggacactatattaag
cggcggctgcgacgttccggactctttaacaagaagctgggactgcagcgcattcgcagc
atattgggcaacagcaacaccaccataggcatagtgcgagatgtgtttccagcggtgcag
gtgttaggtgatgaactggagcgcatgcatccacgcatctacaatggtgtcgcgagacag
atatgccgcaatcctggcggcgagtttcacacgccggatgctgtaagtttgctgctgggc
gcggtgggtcgtgaactgttccgtgttgagatcacgtggagcaaggtgatctcattattt
gctatagccggtggtctatcggtggattgtgtgcgccagggtcatcccgagtatttgcca
aagcttatggagagcgtctccgaagtaatcgaagatgagctggtaccttggataaatgaa
aatggtggatggagtggcatcaatacgcacgtattacccacaaccaacagtctaaatcct
ttggagtggacaacgctggtcattggtgttgtatttggtttgattttactttttatgttt
tttcgctttattgtcaacacattgattcccaaaatataccaacgatttacgagctga

DBGET integrated database retrieval system