KEGG   Drosophila virilis: 6628564
Entry
6628564           CDS       T01066                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dvi  Drosophila virilis
Pathway
dvi00230  Purine metabolism
dvi01100  Metabolic pathways
dvi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6628564
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6628564
Enzymes [BR:dvi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     6628564
SSDB
Motif
Pfam: Guanylate_cyc AC_N KCT2 HNF-1_N
Other DBs
NCBI-GeneID: 6628564
NCBI-ProteinID: XP_002051062
FlyBase: FBgn0201434
UniProt: B4LUP9
LinkDB
Position
Unknown
AA seq 1168 aa
MPEEKATAAANLENGQTTAASTPSKAKRLRTPPRRRPPNEGDVVAGGVGITGGGVVILPQ
HVLNELYHNYSIKQRRSGLKWFLFAAVLFNLWTIFIPWEQALTTRVVNCCVFKAYMTLGA
LLHIGRRSEQPAFRRFRQPLLTIVPRALWLLSMLHFAAYVMLQASFSPRDVLGWAILLNF
LIYVTLPLPLIFLGLVVGFCTYFNCLSLPVGFSRPDPLISDQAAANAVLIATAALIGLLY
YFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAF
KKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILG
DCYYCISGAPDERPDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQ
RQWQFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGL
KTYFITKVVKPFASPCAKKIHETKAENGNHSPDSNASSNDSNENVDDDNDATVDDEELLA
QSVVLNGHSPTAAEDEEEQIKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNLQLEQA
YAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVAISIAESF
SGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHIVSESEFN
ATAGLEEVVTAEHLLPESFVEQMREAVPTERVLYPSYLSNFSVLILIAIAVIAQLTHLTK
ILLLLSIAALHCYFNVCIMQDLYALEDDLAHQPLISTRYCASGLLLVAALSLSFLARHMD
HEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNAKRSHDDLYSQSYA
EVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGST
YMAASGINLQRNLRNDAPITERWSHLALLVEFALELKHALHGINEQSFNHFVLKMGINHG
PITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEETCNILEQFGYTFQQRGLVA
VKGKGQLMTYYLQGKSESSAAEPKAAVELHEPEAVPAAAPLSLDCSAELEADIKTPLLKL
KAQDAATETNPETCLGNGTLAESQSLLE
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgccggaagagaaggcgacagcagctgccaatctcgagaatggccagacaacggccgca
tccacgccgagcaaagccaaacgcctaaggaccccaccgcgccgtcggccacccaacgag
ggcgatgtggttgcgggcggtgtgggcatcacgggcggcggcgttgtcatcctgccgcag
cacgtactcaacgaactctatcacaattattccatcaagcagcgacgcagcggcctcaag
tggtttctattcgcggccgttctctttaatctctggaccattttcataccctgggagcag
gcattaacaacaagggtggtcaactgttgcgtgttcaaggcctacatgacgctgggggcc
ctcctgcacattggacgccgttcggagcagccggcctttagacgcttccgtcagccgctg
ttgacgattgttccgcgcgccttgtggcttctctcgatgctgcattttgccgcctacgtg
atgctgcaggccagcttctcgccgcgagacgtgctcggctgggccatactattaaacttc
ctgatatatgtgacgctgccgttgccgctgatttttctgggcctagtcgttggcttttgc
acgtatttcaattgcctgagtctgcccgtaggcttttcacggccggatccgttaatctca
gatcaggcggcggctaatgcggttttaatagccaccgcagctttaattggtctattgtat
tacttcatgggcgaggccaagcagaagcgcgcctttttggaggccaaaaagagtctggag
gttaagatggtcatcgaggagcagtcggcggagcaggaacgcttgctactatctgtgctg
cccaagcatgtggccattaagatgcgcgaggacttgggctcatccagctcggaggctttt
aaaaagatttacatgagtcggcacgagaatgtcagcatactgtatgcggatattgttggg
tttaccgccatctcctcgacgtatagcgcccaggatctggtaaaaatgctaaacgagctc
ttcgcacgcttcgacaggctcgccgagaagtaccaacagctgcgcattaaaattctcggc
gattgctattattgcattagtggagcgcccgacgagcggccggatcatgccgtgctctgc
gtacacatgggactttcaatggtgaaggccatcaagtatgtgcaacagaaggcaaactca
cctgttgatatgcgtgtgggcatacacacgggtgctgtcctggctggcatactcggtcag
cgtcagtggcagtttgacgtttactccaaggacgttgagctggctaataaaatggaatcc
agcggcaaggccggacgcgtgcatatttccgacaagactttggcctttctcaatggcgag
ttcgaggtggaaccggcctttggtgagaagcgcgaagagttgctgcgcattgctggtctg
aagacctatttcattaccaaagtggttaagccgttcgcctcgccttgcgccaagaaaatc
cacgaaaccaaagcagaaaatggcaatcatagtccggattctaatgccagcagcaacgat
agcaacgaaaatgtcgacgatgacaatgatgccacagtggatgacgaggagctattggcg
cagagtgttgtactcaatggacacagcccaacagcggctgaagatgaggaagaacaaatc
aagctcgagaactttaagcagcgtctaaaagatgagctcgtaacgcgagatggacatgaa
aacctgactaaggacacgaacatcttcttgcgcttcaagaatctgcagctggagcaggcc
tatgccgtctatcgggaaccgtatagttcgctgcccttgctggccgctttgttggtgcag
tgcatcgatgtgctgtactcctatctggtgttgccgcgctccacgctgcatttcattaac
attgccgcaccgctggtgcccattgccatgctggtggccataagcattgcggaaagcttt
agtggcatgctgcccaagttctttgtggatgtgagcaagcgcttcaatgacattaccttc
gtgcgcgagctggcagccataattatagcacttaccattggcctcagcaatgtcatcgac
atgttcttcttcgttaccttcgtgcgcaccgagcacattgtcagcgagagcgaattcaat
gccacggccggcttggaggaggttgtcaccgccgagcacctgctgcccgaatcgtttgtg
gagcaaatgcgcgaggcggtgcccaccgaacgtgtcctatatccgtcctatttgagcaac
ttcagtgtcctcatactcattgcaattgctgtgattgctcagctcacgcatttaaccaag
attcttctgctgttgtccattgcggctctgcattgctatttcaatgtgtgcatcatgcag
gacttgtacgctctggaagacgatctggcacatcagccgctcatatcaacacgctattgt
gcctcgggtctgcttctggtcgccgcattgtctctcagttttctcgcccggcatatggac
cacgaggatcgtgttatattcaaatggaaaaccgaggtggccgagcaaaaggaaaccgcc
aacgatatgcgtcagcgtaatgaggctttggtctacaatgtgctgcccgtgcatgtggcc
gagcactttatgaagaacgccaagcgttcccatgatgatctctactcccaaagctatgcc
gaggtgggtgtgctgttcgccagcatgcccaacttttcagatttctactcggaggaaaca
gttaacaatcagggcctggagtgcctgcgttttctgaatgaggtcatctctgatttcgac
gcgctgctggagctgccccagtttcaagacatcattaaaatcaagactattggttcgact
tacatggccgccagtggcatcaatttgcagcgaaatctccgtaatgatgctcccattacc
gaacgctggtcccatctggctctgctagtggagtttgcgctggagctcaagcatgcgctg
cacggcatcaacgagcagtcgttcaatcatttcgtgcttaaaatgggcatcaatcatgga
cccattacggctggtgtgattggcgctcggaagccgcactacgatatctggggcaatacg
gtgaatgtggcctcgcgcatggagagcaccggcaaagcgggcgccattcaggtaaccgag
gagacctgcaatatcctggagcaattcggttatacgtttcagcagcgcggcctggtggca
gtcaagggcaagggtcagctgatgacctactatttgcagggcaaatctgagagcagtgca
gcggagcccaaggcggccgtagagctgcatgagccggaggcagtgccagcggccgcgcca
cttagtctggactgcagcgcagagctggaggcggatattaagacgccgctgctaaagctc
aaggcacaggatgcagcaacggaaaccaatccggaaacgtgtttgggcaatggaaccttg
gccgaatctcaatcgttgttggagtaa

DBGET integrated database retrieval system