KEGG   Drosophila virilis: 6635496
Entry
6635496           CDS       T01066                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
dvi  Drosophila virilis
Pathway
dvi04013  MAPK signaling pathway - fly
dvi04214  Apoptosis - fly
dvi04215  Apoptosis - multiple species
dvi04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6635496
   04391 Hippo signaling pathway - fly
    6635496
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6635496
   04215 Apoptosis - multiple species
    6635496
SSDB
Motif
Pfam: TNFR_c6 PhoR DUF1754 Comm
Other DBs
NCBI-GeneID: 6635496
NCBI-ProteinID: XP_002059085
FlyBase: FBgn0202379
UniProt: B4MD82
LinkDB
Position
Unknown
AA seq 405 aa
MQPLIQRGSAASRAAAAAAAAAAAATKLATTSSSKCNSNNKNNNNNLTLAIMRTKKATAT
ATTKTNANSKFHKRRRRRQRSSSSTTTATATATGATTIRRRSSIPYLSRTGAYLTLLLLT
TTCSLCAVAAASAASASAAAAAVAAAAASATNGASASGFVLPSSPCAPQHWWDQLQHKCT
PCTSCQGEMMTHRPCQLHIDTVCRSIYDLPIDWVRVSRTEPNWKERRKFSEYEHFDHPTP
LQHLTHEQLQQLHEEAAAALPLDWQTGALFIAALACLLFFSVAACILIHHMRQWRRMERR
LDQDVEELSTKLMAKLAEVQSLDGGTFFIGNADALRGLPASAMTSASASASAAQSGIFQP
QHVLLPVEKHAKHHERRILKTLQPGNVYIEESNGLGAGVFAGSKG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcagccgttaatacaacgcggcagcgcagccagcagagcagcagcagcagcagcagca
gcagcagcagccgcaacgaaattagcaacaacgagtagcagtaaatgtaatagtaacaac
aaaaacaacaacaacaacttaacattagctataatgcgaacaaaaaaagcaacagcaaca
gcaacaacaaaaacaaacgcaaactccaaatttcacaaacgtcgacgaaggcgacagcgc
agcagcagcagcacaacaacagcaacagcaacagcaacaggagcaacaacaatccgtaga
agaagcagcatcccatatctaagcagaactggcgcctacctgacgcttctgctcctaacc
acaacatgttccttgtgcgctgttgccgccgcatccgctgccagcgcttcggctgccgcc
gctgccgtcgccgctgccgctgcctctgccacgaatggcgccagcgccagtggctttgtg
ttgcccagttcaccctgtgcaccgcagcactggtgggatcagctgcagcacaagtgcacg
ccctgcaccagttgccagggcgagatgatgacccatcgcccgtgccagctgcacatcgat
accgtttgcaggtccatttacgatctgcccatcgattgggtgagggtgtccagaacggag
ccaaactggaaggagcgccgaaagttttcggaatatgagcattttgatcatccaacgccg
ctgcagcatttgacccacgagcagctgcagcagctgcacgaggaggcagccgctgccttg
cccctcgactggcagacgggcgcactctttatcgcggcgctcgcctgcctgctcttcttc
tcggtggccgcctgcatactcatccatcatatgcgccagtggcgccgcatggagcgccga
ttggatcaagatgtggaagagttgtccacgaagctgatggccaagctggccgaggtgcag
agtctggatggtggcaccttcttcataggcaatgcggatgcgctgcgcggtctgcccgcc
tcggcaatgacgtcggcgtcggcgtcagcgtcagctgcacagtcgggcatctttcagccg
caacatgtgctgctgcctgtggaaaagcatgcgaagcatcacgagcgacgcattctgaaa
accctgcaaccgggcaacgtctacatcgaggagagcaacggattaggagctggtgtcttt
gccggctcgaagggctga

DBGET integrated database retrieval system