KEGG   Drosophila virilis: Dvir_GJ11663Help
Entry
Dvir_GJ11663      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dvi  Drosophila virilis
Pathway
dvi00020  Citrate cycle (TCA cycle)
dvi00190  Oxidative phosphorylation
dvi01100  Metabolic pathways
dvi01200  Carbon metabolism
Module
dvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dvi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dvir_GJ11663
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dvir_GJ11663
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dvir_GJ11663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 6624467
NCBI-ProteinID: XP_002047912
FlyBase: FBgn0198918
UniProt: B4LF66
LinkDB All DBs
Position
Unknown
AA seq 651 aa AA seqDB search
MTLLKAKCLLRLPSTKSFNRFGFYRFWHVSQVMRDCDSDYELKDHKYDAIVIGAGGAGMR
AGFELAKSGFKTAMLSKLFPTRSHTVAAQGGVNAALSNMDKDDWKFHFYDTVKGSDWLGD
QNAIHYMCREAMAAVHELDQYGMPFSRREDGKIYQRPFGGQTLGYGKGGVARRSCAVADR
TGHALIHTLYGQTLKYGDLCHYYVDYFVLDLIMEDSRCLGCLAWCLDDGTFHRFIAKNTV
VASGGCGRVYFSSTAGHTCTGDGNAWVSRAKLPLMDMEFVQFHPTGMYGAGCLITEGVRG
EGGFFVNSKGERFMEQYAPEAKDLASRDVVARAMTMEVLKGNGCGPLKDHVHLQLHHIDP
EIIYKRLPGIVTTARIFAKVDVTKEPVPVLPTVHYNMGGVPTDFMGRVVTLDDEFKDKII
EGLYSCGETSCASVHGANRLGANSLLDLVVFGRSCAMDIAANSCPGDTPPDVSDSATEKS
MDNFKKLRNADGKTPTAALRMELQRTMTKHAAVFREGKLLNEGLEKVIQLCQQFKDIKVF
DRTLVWNTDLVETLELQNMLANAVHIITAMENRKESRGSHAREDFPKRLDEYDYSTPISG
QKMKPLEEHWRKHTLTFAQDDEGCVVIKYRQVIDKTLDDSINSIPPAPRTY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgactcttttaaaagctaaatgtctgttacgattgccatctacaaagtcgttcaatcgc
ttcggcttctatcggttctggcatgtgtcccaggtgatgcgcgactgtgactccgattac
gaattaaaagatcataaatatgatgctattgtaattggggctggtggcgctggaatgcgt
gcaggattcgagttggccaaaagcggttttaagactgcgatgctatcgaaactattcccg
acaaggtctcacacggtggcagcacaaggcggggtaaatgctgctctgagcaatatggac
aaggacgattggaagttccacttctacgacacagtgaaaggcagcgactggttgggggat
cagaatgccatccactatatgtgccgagaagcgatggcagccgtacacgagctcgaccaa
tatggcatgccattttcacgaagggaggatggcaagatatatcagcggccatttggagga
cagacactaggctacggcaagggtggcgtagctagacgttcctgcgcagtggccgatcgc
actgggcacgcacttattcacacactctatggtcagactctgaaatacggggatctttgc
cattattatgtagactattttgtgctcgatttaataatggaagattcccgttgtttgggt
tgcctggcttggtgtttggatgatggcacctttcatcggttcatcgccaagaacactgtg
gttgcgtctggcggctgtggacgcgtgtatttttcaagcactgccggccatacttgcact
ggggacggcaatgcttgggtttcacgcgccaaacttccgcttatggacatggagtttgta
cagttccatcctaccggtatgtacggagccggctgtcttatcactgaaggcgttcgcggc
gagggtggcttctttgtcaattctaagggcgagcgttttatggaacaatatgcaccggag
gccaaggacttagcctcacgcgatgttgtagcgcgtgctatgacaatggaagtgttgaaa
ggaaatggctgcggccccctcaaagaccatgtccacttacagcttcaccatattgatcct
gaaattatttacaaacgtctgcctggaatagtgacaacagctagaattttcgctaaagtt
gatgtaacaaaggaacccgtgccggtgttgcccaccgtacactacaacatgggcggtgta
cctactgattttatgggtagagtggtaacacttgacgatgagtttaaagataaaattatc
gagggcctctactcttgtggagagacttcgtgcgcttcggtccacggtgcgaatcgtttg
ggcgccaactctttgcttgatttggttgtctttggacgctcatgcgctatggatattgca
gccaatagctgcccaggagatacgccacccgatgtgtccgacagtgccactgaaaaatcc
atggacaacttcaaaaagttgcgaaatgccgatggcaaaactccaacggccgcgctgcga
atggaactgcagcggaccatgaccaagcatgcggcggtcttccgcgagggcaagctctta
aatgaagggctagaaaaggtcatccagctgtgccaacaattcaaggatataaaggtgttt
gatcgaactctagtgtggaatacggacctcgttgagacgctggagttacaaaatatgctg
gccaatgctgtgcacatcatcactgccatggaaaatcgcaaggagtcccgtggctcgcac
gctcgtgaggactttcccaagcgcttggacgaatacgactatagcactcccatttcgggg
cagaagatgaaaccattagaggaacactggcgcaaacacaccttgacctttgctcaggac
gacgagggctgcgtcgtcatcaaatatcgacaggtcattgacaaaactttggatgactct
ataaattccataccacccgctccgcgaacctactga

DBGET integrated database retrieval system