KEGG   Drosophila virilis: Dvir_GJ12199Help
Entry
Dvir_GJ12199      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dvi  Drosophila virilis
Pathway
dvi00480  Glutathione metabolism
dvi00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dvir_GJ12199
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dvir_GJ12199
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dvir_GJ12199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 6624546
NCBI-ProteinID: XP_002046960
FlyBase: FBgn0199450
UniProt: B4LFS5
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MSSGRHLAKGSATPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTEKPDW
LFEKNPLGKVPALELVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQEKLLIER
FGAVLGAFFKASDGGELEPFWCGLDKYEQELSRRGTPFFGGEQTGILDYMIWPWCERLEL
LQLQRGDDYNYDEQRFPQLTQWLERMKRDPAVMAFYMEAEVQAEFLRTRSAGKPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggcagacatttggcaaaaggctcagcgacgcccgatgtgcccgaggatggc
attttgcgtttgtactccatgcgcttctgtccgtttgcgcagcgtgtgcatctggtgctg
gacgccaaacagataccctatcacagcatctacataaatctcacagagaaaccagactgg
ctctttgaaaagaatccgttgggcaaggtgccggcgctggagctggtgcgtgagcctggc
ccgcccgtgctgaccgaatcgttgctcatctgcgagtacctcgacgagcagtatccactg
cgtccgctctatccgcgtgatccgcttaaaaaggtgcaggagaagctgctcattgagcgc
tttggagccgtgctgggcgccttcttcaaggcatccgatggcggtgagctggagcccttc
tggtgcggcctggacaagtatgagcaggagttgagcaggcgtggcacgcccttctttggc
ggcgaacaaactggtatattggattacatgatttggccctggtgcgagcgtctggagctg
cttcagctgcagcgcggcgatgactacaactacgatgagcagcgctttccacagctgacg
cagtggctggagcgcatgaaacgtgatcccgcagtgatggcattctatatggaagctgag
gtgcaggcggaattcttgcgtacgcgcagcgctggtaaacccaattataatcttctggtg
aaggatgcctga

DBGET integrated database retrieval system