KEGG   Drosophila virilis: Dvir_GJ13734Help
Entry
Dvir_GJ13734      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
dvi  Drosophila virilis
Pathway
dvi00250  Alanine, aspartate and glutamate metabolism
dvi00280  Valine, leucine and isoleucine degradation
dvi00410  beta-Alanine metabolism
dvi00640  Propanoate metabolism
dvi00650  Butanoate metabolism
dvi01100  Metabolic pathways
Module
dvi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Dvir_GJ13734
   00650 Butanoate metabolism
    Dvir_GJ13734
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dvir_GJ13734
   00280 Valine, leucine and isoleucine degradation
    Dvir_GJ13734
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dvir_GJ13734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dvi01007]
    Dvir_GJ13734
Enzymes [BR:dvi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Dvir_GJ13734
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Dvir_GJ13734
Amino acid related enzymes [BR:dvi01007]
 Aminotransferase (transaminase)
  Class III
   Dvir_GJ13734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 6622791
NCBI-ProteinID: XP_002048010
FlyBase: FBgn0200955
UniProt: B4LFN4
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MSSFLVNVLPKAHTYARSKCSIYGVNCMKAYSTNWEPKEPIVRTKTIPGPKSAELKSQLS
AVQSTGTVQFFADYEKSTGNYIFDVDGNALLDVYTQISSVPLGYNHPRLLNIFKDENNLK
TLINRPALGVFPGKEWPDKLNSILLNIAPKGLNKITTMMCGSCSNENAFKSIFLWYQTKI
RGEKGFTAEEMNSCMINMPPGAPNLSILSFKGAFHGRTLGALSTTHSKYIHKIDVPSFDW
PIASFPQYKYPLEDNVAENKKEDEKCLSEVQSLIEEYKKKDKPVAGVIVEPIQSEGGDNE
ASPAFFRALQKICKSNGVALLIDEVQTGGGSTGKFWCHEHFNLEYPPDVVTFSKKLQLGG
YFHNDDFAPKEPYRIFNTWMGDPGKVILLEEILKVIKDEKLMANVEAAGKVLKQGLLNLE
SEFPQLLNSTRGRGTFLAVNCSNSKVRDSIVSTLRLNGIQTGGCGEVSIRFRPALIFKEA
HANIVLDRFRNVLRSL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcagttttttggttaacgtgttgccaaaggctcacacgtatgcgagaagtaaatgc
agcatttatggtgtaaattgtatgaaagcttattctacaaattgggagcccaaggaacca
attgtgcgtacaaagacaatacctggaccaaaatcagctgagcttaagagtcaattgagt
gcagttcagagtacgggcactgtgcaattctttgccgattatgaaaagtcgactggaaac
tatatttttgatgttgatggcaatgctttacttgatgtttacactcaaatttcatcagta
cctcttggctataaccatccgaggctcctcaacattttcaaggatgaaaacaatttgaaa
actctgataaatagaccagcacttggtgtgtttcctggaaaggaatggccggacaaactg
aactcgatcttactgaatatagctccaaagggattgaacaaaatcacgacaatgatgtgt
ggatcatgttcaaacgaaaatgctttcaagagcattttcctttggtaccaaactaaaatt
cgaggagaaaagggattcactgcagaagagatgaactcgtgtatgattaatatgccacct
ggcgccccgaacctcagtattctttccttcaaaggagcttttcatggtcgaacactagga
gccttatctaccacacactcaaaatatatacataaaattgatgttccttcttttgactgg
cctattgcatcatttccgcaatacaagtatccattggaggacaacgttgcggaaaataaa
aaggaagatgagaagtgcttaagtgaagtgcaaagtctcatagaggagtacaaaaagaaa
gataagcctgttgctggtgttattgtggagcccatacaaagtgagggcggtgacaacgaa
gcttcgcctgcatttttcagagctctacagaagatttgtaagagtaacggcgttgcactt
ttgattgatgaggtacaaactggaggaggaagcactggcaagttttggtgccatgaacat
ttcaacctcgagtatccacctgatgtggttacgtttagtaagaaactgcaacttggagga
tatttccataatgacgactttgcaccaaaggaaccttacaggattttcaacacatggatg
ggtgatccaggaaaagtaatccttttggaagaaatattgaaagttattaaagacgagaaa
ttaatggcaaatgttgaagctgctggcaaagttttaaaacagggtctattgaacttagaa
agcgaatttccccaactattgaactctacccgaggacgtggcacattcttggctgtaaac
tgctctaactccaaagtaagggactcgatagtcagcactttaaggctgaatggtattcaa
acaggtggctgtggagaagtttccattcgattccgcccagctttaatctttaaagaagcc
catgcaaatattgttttggatcgatttagaaatgttttacgctcactgtaa

DBGET integrated database retrieval system