KEGG   Drosophila virilis: Dvir_GJ15413Help
Entry
Dvir_GJ15413      CDS       T01066                                 

Gene name
Dvir_Gpdh
Definition
(RefSeq) glycerol 3 phosphate dehydrogenase, isoform B
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
dvi  Drosophila virilis
Pathway
dvi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dvir_GJ15413 (Dvir_Gpdh)
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     Dvir_GJ15413 (Dvir_Gpdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C F420_oxidored Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 6629022
NCBI-ProteinID: XP_015028171
FlyBase: FBgn0013081
UniProt: P07735 A0A0Q9W976
LinkDB All DBs
Position
Unknown
AA seq 353 aa AA seqDB search
MAEKVNVCIVGSGNWGSAIAKIVGANAAALPEFEERVTMFVYEEMIDGKKLTEIINETHE
NVKYLKGHKLPTNVVAVPDLVEAAKNADILIFVVPHQFIPNFCKQLLGKIKPNAIAISLI
KGFDKAEGGGIDLISHIITRHLKIPCAVLMGANLANEVAEGNFCETTIGCTDKKYGKVLR
DLFQANHFRVVVVEDADAVEVCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRF
VDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEDLEKEMLNGQKLQG
PPTAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPKDLIDCIRNHPEHMQTL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaaagtaaatgtttgcatcgtgggctctggcaactggggttcggccatagcg
aaaatcgtgggcgccaatgcggccgcgctgcccgagtttgaggagcgcgtcacaatgttt
gtctacgaggagatgattgatggcaagaagttaacggaaattatcaatgaaacgcacgag
aatgttaaatacctgaagggacacaaactgccaacaaatgtggttgctgtacctgatctg
gttgaggctgccaagaatgccgatatactaatctttgtggtgccacatcaatttatacca
aatttctgcaagcaattgctgggcaagatcaagccaaatgccattgccatatccctgatc
aagggcttcgataaggccgagggcggcggcattgatctgatatcgcacattattacccgc
catttgaagataccatgcgccgtgctgatgggcgctaatctggccaacgaggtggccgag
ggcaacttttgcgagacgacaatcggctgcacggacaaaaagtacggcaaggtgctgcgt
gatctcttccaggcaaatcattttcgtgtcgtggtcgttgaggatgccgatgccgttgag
gtttgcggcgccctgaagaacattgtggcctgtggtgcgggctttgtcgatggtctcaag
ctgggcgataatactaaggcagcggtcattcgtttgggtctcatggaaatgatacgcttt
gtcgatgtcttctatccgggcagcaaattgtccacattctttgagagctgcggtgttgcg
gatctcatcacgacatgttacggtggtcgcaatcgtcgtgtctcagaggcttttgtcaca
tcgggcaagacaatcgaagatctggagaaagagatgctcaatggccaaaaattgcagggc
ccgcccactgccgaggaggttaactatatgttgaaaaacaaaggcctggaggataaattc
ccattgttcaccgccatacacaaaatttgcacaaatcagcttaagcctaaagatttaatc
gattgcatacgcaatcatcccgagcatatgcaaactttgtaa

DBGET integrated database retrieval system