KEGG   Drosophila virilis: Dvir_GJ17051Help
Entry
Dvir_GJ17051      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dvi01009]
    Dvir_GJ17051
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dvi03019]
    Dvir_GJ17051
   04131 Membrane trafficking [BR:dvi04131]
    Dvir_GJ17051
   03036 Chromosome and associated proteins [BR:dvi03036]
    Dvir_GJ17051
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dvir_GJ17051
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dvir_GJ17051
Messenger RNA biogenesis [BR:dvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dvir_GJ17051
Membrane trafficking [BR:dvi04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Dvir_GJ17051
Chromosome and associated proteins [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dvir_GJ17051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 6633570
NCBI-ProteinID: XP_002057375
FlyBase: FBgn0204228
UniProt: B4M7U4
LinkDB All DBs
Position
Unknown
AA seq 1204 aa AA seqDB search
MSSPIVTRRGAQQAKIQTRAMVKSKSTSTSSSSATAAAAAAAAAANAATGPNANSSNGAG
SCGPRKPSPALQEAKRRARNMLKSQNNGTAAQLEPVIDIFQNALNAKSMHRGPTALIYDE
TMSEHCCLWDSTHQERPERFTRTLERCRELKLVERCLQLNSRLATKDEILKLHSMEHYER
LEQTSAVHDAEAMEELSSHYDAIYIHPSTFRLSLLASGSTIELVEQLLLGKAQNGMAIIR
PPGHHAMKSEFNGYCYFNNVALAAQHALDAHQLQRILIIDYDVHHGQGTQRFFYNDSRVL
YFSIHRYEHGSFWPNLQESDYHAIGAGSGTGYNFNVPLNAKGLGNGDYMAIFQQLLLPVA
MEYQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLHLANCRVAVVLEGGYCVESL
SEGAALTLRALLGDPCPALVEPLQLPSPVLREALLNCIYVHRPYWRCLQLQQTYTPGELQ
SASTIPLHRVQRIWLGGPPPAPDQRYPTRGTSAQLSAAVVASNASRLSLLRAETQLSVPP
VRVCYAYDAQMLQHFNLHDATHPEQPMRIRQIHQMHEDYQLLDRMQQLAARAATTDEVCL
AHTRAHVNSVRRLLGRSVEELQQVGAGYNSVYLHPRTFECAILASGAVLQAVDSVLRGQS
RSGICNVRPPGHHAEPDQPHGFCIFNNVAIAAQYWIREYALERILIVDWDVHHGNGTQHI
FESNPKVLYISVHRYEHGAFFPKGPAGNYDVVGKNAGRGFNVNIPWNKKGMGDLEYALAF
QQLILPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGLFTHWLSALAGGRIIVCLE
GGYNVNSISYAMTMCTKTLLGDPVPTPQFATTAHQRSPTVAFQSCVETLQLCVEQQRHHW
KSLVFGCKLPQFVLGENNNEDFLAATMDRLSISNDDPLGAAGGDIDAQPDPGQDRPSGSK
PKVKVKTLSEFMAEHKEALEQQEMFAIYPLKSCPHLSLLRPEEVPKSIKTNGACGDCAST
VENWVCLSCQSIGCGRYINEHMEQHCRRAKHPLVLSFSDLSVWCYECSAYIDHPLLYAYQ
NLAHLDKFQEPMAWTHGCMQRSDGCYPIEAEHQDNDRNSDRDKDKDKDKDSGSSNTNSSS
IGSGYYIQLERNNXHLVVRVLDAITDYMCTLCPPLRHILQLLVEHMWPLLERIYLKLIQY
FLAH
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaccgatcgtaacgcgacgaggcgcacaacaggccaaaatacaaactcgcgcc
atggtcaagtcgaagtcgacgtcgacgtcgtcgtcatcggcgacggcggcggcggcggca
gcagcagcagcagcgaacgcagcgacggggccgaacgccaacagcagcaacggcgccggc
agctgcggtccacgcaaaccgagtccagcgcttcaggaggcaaaacgtcgggcgcggaac
atgctcaaatcgcagaacaacggcacagccgcccagctggagccagttatcgatatcttt
cagaatgccctcaacgcgaagagcatgcatcgtggccccaccgcgctcatctatgatgag
accatgagcgagcattgctgcctctgggacagcacacatcaggagcgacccgaacgcttt
acgcgcaccctggagcgatgtcgcgagctgaagctagtggagcgttgcctgcagctaaac
tcccgtctggcgacaaaggacgaaatcctgaagctacactcaatggagcattacgagcga
ctggagcagacgtcggccgtgcacgatgcggaggctatggaggagctaagctcccattat
gacgccatctacatacatccgtccacgttcaggctgtcgctcttggccagcggctcgacc
atagagctggtggagcagctgctgctgggtaaggcgcagaatggcatggccataatacga
ccgccgggccatcatgcgatgaagtcggaattcaatggttattgctattttaataatgtg
gcgcttgctgcacagcatgctctcgatgcgcaccagctgcagcgcatcctgattatcgac
tacgatgtgcatcatggccagggtacgcagcgcttcttctataacgattccagggtcttg
tatttctcgatacatcgctatgagcacggcagcttctggccgaatctgcaggaatcggat
taccatgcgattggcgctggctccggcaccggctacaatttcaatgtgccgctgaatgcc
aagggcttgggcaatggcgattatatggccatattccagcagctgctgctgccggttgcc
atggaatatcagccggagctgattattgtctcggccggctatgatgcggccctgggctgc
ccggagggtgagatggaggtgacgcccgcctgctatccgcatctgctcaatccgctgctg
catttggccaattgccgtgttgccgttgtgctcgagggcggctactgtgtggaatcgttg
tccgagggcgccgccttgacgctgcgcgccctgctgggtgatccgtgcccggcgctggtg
gagccgctgcagttgcccagcccggtgctgcgcgaggccctgctcaactgcatctatgtg
catcgtccgtactggcgctgcctgcagctgcagcagacctatacgcccggcgaactgcag
tcggccagcacgattccgttgcatcgcgtgcagcgcatttggctgggcggcccgccgcca
gcgccagatcagcgctatccgacgcgcggcacctccgcccagctgagtgccgctgttgtc
gccagcaatgcgtcccgtttgagtttgttgcgcgccgagacgcagctgtcggtgccgccg
gtgcgtgtttgttatgcctacgatgcccaaatgttgcagcatttcaatttgcacgatgcc
acccatccggagcagccgatgcgcatacgtcagatccatcagatgcacgaggactatcag
ctgctggatcggatgcagcagctggcggcgcgcgccgccaccacggacgaggtgtgcctg
gcccatacgcgcgcccatgtcaattcggtgcgtcgcctgctgggtcgcagcgttgaggaa
ctgcagcaagtgggcgccggctacaattcggtgtacctgcatccgcgcaccttcgagtgc
gccatactagcctccggcgccgtactccaggcggtcgatagcgtactgcgcggccaatcc
cgcagcggcatctgcaatgttcgaccgccgggccatcacgccgaaccggatcagccgcac
ggcttttgcatattcaataatgtggccattgcggcccagtattggatacgggaatatgca
ctcgagcgcatcctcattgtcgactgggatgttcaccatggcaacggcacacagcacatc
tttgagtccaatcccaaggtgctctacataagtgttcatcgctacgagcatggcgccttc
tttcccaagggtcccgccggcaactacgatgtcgtgggcaagaatgccggccgtggcttc
aatgtcaatattccctggaataagaagggcatgggcgatctggagtacgcattggccttt
cagcagctaatcctgcccatcgcctacgagttcaatccgcagctggtgctcgtctcggcc
ggcttcgatgcggccattggggatccgttgggcggctgcaaggtgacaccggagggctac
ggcctgttcacccattggctgtcggccttggccggcggtcggatcatcgtctgcctggag
ggcggctacaatgtcaactccatatcgtatgcgatgaccatgtgcactaaaacgctgctg
ggcgatccggtgccgacgccccaattcgcaacgaccgcacaccaacgctcaccgacggtg
gccttccagagctgcgtggagacgctgcagctgtgcgtggaacagcagcgtcatcattgg
aagtcgctcgtctttggctgcaagctgccccaattcgttttgggcgaaaacaataacgag
gattttcttgctgctaccatggaccgattgagtatatcaaatgacgatccactcggcgcc
gccggcggcgatatcgacgcacagcccgatcccggccaggaccggcccagcggcagcaag
cccaaagtcaaggtaaaaacgctcagcgagtttatggccgagcacaaggaggcgctcgag
cagcaggaaatgtttgccatttatcccctcaaaagctgcccacacttgagcctgttgcgt
ccggaggaggtgcccaaatcaataaaaacaaacggcgcatgcggcgactgcgcctcaacg
gtggagaattgggtatgcctgagctgccagagcatcggctgcggtcgctatatcaatgag
cacatggaacagcattgccgacgagccaagcatccgctggtcttgagcttcagcgatcta
tccgtgtggtgctacgagtgcagcgcctatatcgatcatccgctgctctatgcctatcag
aatctggcgcatctggacaagttccaggagccgatggcctggacacatggctgcatgcag
cgctccgatggctgctatccgatcgaggcggagcatcaggacaacgacaggaacagcgac
agggacaaggacaaggacaaggacaaggatagcggctccagcaataccaacagcagcagc
attggcagcggctactacatacaactcgagcggaataactgacatttggtggtgcgtgtg
ctggatgccattacggattacatgtgcacgctgtgtccgccgctgaggcacatactccag
ctgcttgtggagcacatgtggccgctgctggaacgcatttacctcaagctgattcaatat
tttctggcccattga

DBGET integrated database retrieval system