KEGG   Drosophila virilis: Dvir_GJ18158Help
Entry
Dvir_GJ18158      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dvi01002]
    Dvir_GJ18158
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dvi04147]
    Dvir_GJ18158
   04090 CD Molecules [BR:dvi04090]
    Dvir_GJ18158
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dvir_GJ18158
Peptidases [BR:dvi01002]
 Metallo Peptidases
  Family M2
   Dvir_GJ18158
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ18158
CD molecules [BR:dvi04090]
 Proteins
  Dvir_GJ18158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 6634022
NCBI-ProteinID: XP_002057486
FlyBase: FBgn0205323
UniProt: B4M8N3
LinkDB All DBs
Position
Unknown
AA seq 849 aa AA seqDB search
MWNCIFIICSTLWSLTRASPQLNLPTPQPEIFYNGYTPNVATTPAQLRADRDRSQRFGPP
YTDDGAGGSGSNSDDGLDDFRYGQTYDERMRLGYAYPTPRLNFSDRADDSPFSADQNPSR
GQENRYANHNYGPTSSSTERNYGNFNDPPNNINQNNGPNYNNRNDQYNYNNNPNVEFVGV
NNRNRFENPYLSNQDRFNLNQGYLERQRYQQDRRYQQELEKLRNLLVETDQKGSLECTAN
VAAQWNFETNVNDFTQTEALNAQQRYVEYQRITAEQSKHINKDLIFDRRLYRQLMLQSEV
GPNSLPLDVLDRYNRLLNEMLFLYNDASICAYQQPFQCDLRYIPHLKDIMAKSRDWDELQ
HTWVEYHRKAGRGMRDNYEQLIDVMQDVASVNNVTNGGEYWFLAYESGNFRQDMDIVWEQ
IRPLYESLHSYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQSWSNVLDILIPYPGRKLI
DVTPRMVEQGYTPLLMFQLAEEFFTSINMSAVGPEFYRNSVFEQPLDRRVLCEPSAWDFC
NRHDYRVKICTDINQRSLISVHHEMAHIQYFLQYRHLPKIFRNGANPAFHQAVGDAIGLS
VSTPKHLQTLGLLQRSLDESSYDINYLFTMAIDKVAFLPFALALDNWRYDVFSGNANKRV
MNCHYWNLREKYSGIKPPVLRSEKDFDVGAKYHIPANIPYIKYFFSTVLQFQLYRRMCLV
AGQYVPNDPRKPLHKCDIYRQPAAGNLLKQLMAKGASQPWQEVLEETLGEGRLDGSALRE
YFAPLEEWLRQESLRTNEYVGWNYDGDYCKRSIETAGLQIFGGYYNGVSRPLMSLLLLTL
SGWLSYLTI
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattgtatttttatcatatgctccacgctatggagcctgactcgtgctagtcca
caacttaatttgcctacaccgcagccggagatcttctacaatggctacacgcccaatgtg
gccacaactcccgcccagctgagagcagatcgcgatcgtagccagcggtttgggccgccc
tatacggatgacggggctggaggcagcggtagcaatagtgacgatggactggacgacttt
aggtatggtcagacctatgacgagcgcatgcgactgggttacgcctatcccacacccaga
ctgaattttagtgatcgcgccgatgattcacccttcagtgcggatcagaatcccagtcgt
ggccaagaaaatcgttatgcgaatcacaattatggaccaacatccagcagcaccgagcgc
aactatggcaattttaatgatccgcccaacaatattaatcagaataatggacccaactac
aacaatcgaaacgatcaatataactacaataacaatcccaatgtagaatttgtgggggtt
aacaatcgcaatcgatttgagaacccctatctatcaaatcaggatcgatttaatctgaac
cagggctatctggagcgtcaacgttatcaacaggatcgtcgctatcagcaggagttggag
aagttacgcaatttgctggtcgaaacggatcagaagggctcgctcgagtgcaccgccaat
gtggcggcccaatggaatttcgagacaaacgtaaacgattttacacaaacggaagcgcta
aatgctcagcaacgttatgtggagtatcagcgcataacagccgaacaatcgaagcatatt
aataaggatctcatattcgatcgacgtttatatagacagctaatgctgcaatctgaagtt
gggcccaattccttacccctggatgttttagacagatataatcgcttgttgaacgaaatg
ctattcttgtacaacgatgctagcatttgcgcctatcagcagccttttcaatgcgatctg
cgctatataccccatcttaaggatataatggcgaagagcagagattgggatgagctgcag
catacttgggtggagtatcatcgaaaagctgggcgtggcatgcgcgataactacgagcaa
ttgattgatgtgatgcaggatgtagcctcagtaaacaatgttaccaatggcggggagtat
tggtttttagcctacgaatcgggcaactttcgacaggatatggacattgtttgggagcag
atacgtccgctatacgaaagcctgcactcatatgtacgtcgcaagctgcgagattattat
ggaccagatcgcattaatcgcattgcgcccataccctcccatatattgggcaacatgtac
ggacagtcctggtcgaatgtgctggacatacttataccatatccgggtcgcaagctgatt
gatgttacaccacgcatggtggaacagggctatacgccgctgcttatgtttcagttggcc
gaggagttttttacttcaataaatatgtccgccgtgggaccggagttctatagaaattcg
gtgtttgagcagccactggataggcgcgtcctctgcgagccctccgcctgggatttttgc
aatcgtcacgattaccgtgtgaaaatctgcacggacatcaatcaacgtagtctgattagc
gtgcatcatgagatggcgcacattcaatactttctgcagtatcgccatttacccaagatc
tttcgtaatggtgccaatccagcttttcatcaagctgtgggcgatgcaattggtttgtcc
gtctccacaccaaagcatttacagactttgggactactgcagcgatcgctggatgagtcg
agctatgatattaactatttgtttaccatggctattgataaggttgcttttttgcccttt
gccttggctttggataactggcgttacgacgtcttcagcggcaatgccaataagagagtt
atgaattgtcactactggaatttgcgtgaaaagtattcgggcattaagccacctgtctta
cgctcggaaaaggactttgatgtgggcgcaaaatatcacatacccgcaaatataccctat
attaaatactttttctccacggtgctgcagttccaattgtatcgaagaatgtgtcttgtc
gctggccagtatgtgcccaacgatccgcgtaagccgctgcacaagtgcgacatctatcgg
cagccagccgcaggcaatctgttaaaacaacttatggccaagggcgcgtcccagccatgg
caggaggtgctggaggagaccttgggcgagggtcgcctcgatggcagcgctctgcgtgag
tactttgccccattagaggagtggctgcgtcaggaatcgctgcgcaccaacgagtatgtg
ggatggaactacgatggggactactgtaagcggagcattgagacagcgggcctgcagatc
tttggaggctactacaacggcgtgtccaggccactgatgagcctgctgctgcttacgctc
agcggctggctgagctatctaactatctag

DBGET integrated database retrieval system