KEGG   Drosophila virilis: Dvir_GJ20849Help
Entry
Dvir_GJ20849      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dvi  Drosophila virilis
Pathway
dvi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dvir_GJ20849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dvi01002]
    Dvir_GJ20849
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dvi04147]
    Dvir_GJ20849
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dvir_GJ20849
Peptidases [BR:dvi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dvir_GJ20849
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ20849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 6625430
NCBI-ProteinID: XP_002049267
FlyBase: FBgn0207985
UniProt: B4LJ10
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MFKFVILLSVVACAFGAAVPEGLLPQLDGRIVGGTATTISSFPWQISLQRNGGHSCGGSV
YSAKIIVTAAHCLQSVSASSLKVRAGSSYWNSGGSLVQVAAFRNHEGYNANTMVNDIAVI
RLSSSLSFSSTIKAIGLATYNPANGASAAVSGWGTLSSGSSSIPSQLQYVNLNIVSQSKC
ASSSYGYGSQIRSTMICAAASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA
DVSVLRSWVVSAANSI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtttgtgattttgttgtcagtcgttgcctgcgccttcggtgctgcagttccc
gagggtctgctgccccagctggatggacgcatcgttggcggcaccgccaccaccatcagc
agcttcccctggcaaatctcgctgcaacgtaatggcggccactcctgcggtggttcggtc
tactctgcgaagatcattgtgacggctgctcattgcctgcaatccgtgtccgcctccagc
ttgaaggtgcgcgctggttcctcttactggaactctggcggcagtctggttcaggttgcc
gccttcagaaaccacgaaggatacaatgccaacaccatggtcaacgatattgctgtcatc
cgcctgagctcttcactctccttcagctcgaccatcaaggctattggtctggctacttat
aatcctgccaatggtgcttccgctgctgtctctggctggggtactctgtcctcaggctcc
agctcaattcccagtcagttgcagtatgtgaacttgaacattgtcagccagtccaagtgc
gcctcctccagctatggttatggcagtcaaatcagaagcaccatgatctgcgccgccgcc
agcggcaaggattcctgccagggtgactctggtggcccactggtgtccggtggtgtgctt
gttggtgtcgtctcctggggctatggctgtgcttacagcaactatcctggtgtctacgcc
gatgtgtctgtgctccgctcctgggtggtcagcgctgccaactcgatctaa

DBGET integrated database retrieval system