KEGG   Drosophila virilis: Dvir_GJ21713Help
Entry
Dvir_GJ21713      CDS       T01066                                 

Gene name
Dvir_Mal-A4
Definition
(RefSeq) maltase A4
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dvi  Drosophila virilis
Pathway
dvi00052  Galactose metabolism
dvi00500  Starch and sucrose metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dvir_GJ21713 (Dvir_Mal-A4)
   00500 Starch and sucrose metabolism
    Dvir_GJ21713 (Dvir_Mal-A4)
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dvir_GJ21713 (Dvir_Mal-A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF4635
Motif
Other DBs
NCBI-GeneID: 6624844
NCBI-ProteinID: XP_002049660
FlyBase: FBgn0208832
UniProt: B4LLB6
LinkDB All DBs
Position
Unknown
AA seq 578 aa AA seqDB search
MTTWSSIALLLGLGLLAVDAAAPWWQTASFYQIYPRSFKDSDGDGIGDLNGVTEKLEYLK
EIGVTATWLSPFLRSPMADFGYDISDFKEVDPLFGTMEDFENMVARAKQLNVKIILDFVP
NHSSDECDWFIRSAAGEEKYKDYYIWHPGFLENGERKPPTNWVSVFRGSAWEWHEGRQEY
YLHQFHKKQPDFNFRNPVVREEMNNVLRFWLEKGVDGFRVDAIYHAFEVEADANGNYPDE
PRNDWTNDPDEYGYTHKIYTVDQPETPHLVYEWREILEQFQKENGGDERILMVETWSPIE
IVMHYYGNETAEGAQIPFNFQLISNLHMDSDAYHYEYLINNWLSLMPTGKSANWVIGNHD
KNRVGSRFGADRVDLFNILLLTLPGCSITYQGEELGMLDGYVSWEDTVDPQACNGYEENY
MAMSRDPARTPMHWTNGKLAGFTSGSDTWLPVAQDYAQRNVQTERGAPLSHLNVFKRLQQ
LRQEPTIEQGATEVKAVSGYVLAVKRYLSGNYVYISLFNIFDNIENVNLNDVFSGLPDNF
QYALVTDKSIKQLGDKVSASSVTLMPHEAVVLRSTTTI
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgactacttggtctagcattgccttactactgggattaggcctgttagccgtggatgcg
gctgcgccctggtggcagacggcttccttctatcagatctatccccgctcttttaaggat
agcgatggagatggcattggcgatctgaatggagttaccgagaagctggagtatctgaag
gagattggcgtgacagcgacttggttatcgccattcctgcgctcacctatggctgacttt
ggatacgatatatcggactttaaggaagtggatcctctcttcggcacaatggaagacttt
gagaacatggtagcacgtgccaagcagctaaatgttaaaatcatcttggactttgtgccc
aatcattcgagcgacgaatgcgactggttcattcgctctgctgccggtgaagagaagtac
aaggactattacatctggcatccgggctttttggagaacggtgaacgcaagccgccaacc
aactgggtgagcgtattccgtggctcggcttgggagtggcatgagggacgccaggagtac
tatctgcatcagttccacaagaagcagccggactttaacttccgcaatcccgtcgtccgc
gaggaaatgaacaatgttctgcgtttctggctggagaagggcgtcgacggcttccgcgtg
gacgccatatatcatgccttcgaggttgaagccgatgcgaatggcaactacccggacgag
cctcgcaacgactggaccaatgatcccgacgagtacggctacacccacaaaatctataca
gtcgaccagcccgagacgccacatttagtgtacgaatggcgtgagattctggaacagttc
cagaaggagaacggcggtgacgaacgcatactcatggtggagacttggtccccgattgag
attgtgatgcactactatggcaacgagacagcagagggcgcacagatacccttcaatttc
cagctgataagcaatctgcacatggactccgatgcctatcactacgagtacttgatcaac
aactggctatcgctaatgccgacaggcaagagtgccaactgggtgattggcaatcacgat
aagaaccgcgtcggttcacggtttggagctgatcgcgttgatctgttcaacattttattg
ctcacgctgcccggctgcagtatcacctaccagggcgaggagctgggcatgctagatggc
tatgtctcgtgggaagatacagtggatccgcaggcctgcaatgggtacgaggagaattac
atggcgatgtcccgggatcccgctagaacgcccatgcactggacgaacggtaagttggct
ggtttcaccagcggcagcgacacctggctgccagttgcccaggactatgcccagcgcaat
gtgcagacagagcgcggtgccccgctcagccatttaaatgtcttcaagcgtctgcagcag
ctacgccaggagccaaccattgagcagggagccactgaggtaaaggctgtcagtggctat
gtcttggcggttaagcgctatctgagtggcaattacgtgtacatatcactctttaacatt
ttcgataatattgaaaatgtgaatctgaatgacgtattcagcggactgcctgacaatttc
cagtatgccctggtcaccgacaagtccatcaagcagctgggcgacaaggtctccgccagc
agtgtcacgcttatgccccacgaagccgttgttctgcgctccacaacaactatctaa

DBGET integrated database retrieval system