KEGG   Drosophila virilis: Dvir_GJ21736Help
Entry
Dvir_GJ21736      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
dvi  Drosophila virilis
Pathway
dvi00061  Fatty acid biosynthesis
dvi01100  Metabolic pathways
dvi01212  Fatty acid metabolism
Module
dvi_M00082  Fatty acid biosynthesis, initiation
dvi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dvir_GJ21736
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dvi01004]
    Dvir_GJ21736
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dvi04147]
    Dvir_GJ21736
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     Dvir_GJ21736
Lipid biosynthesis proteins [BR:dvi01004]
 Fatty acid synthase
  Animal type
   Dvir_GJ21736
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dvir_GJ21736
  Exosomal proteins of breast milk
   Dvir_GJ21736
  Exosomal proteins of colorectal cancer cells
   Dvir_GJ21736
  Exosomal proteins of bladder cancer cells
   Dvir_GJ21736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR KAsynt_C_assoc Ketoacyl-synt_C Thioesterase PS-DH ADH_zinc_N_2 ADH_zinc_N PP-binding adh_short ACP_syn_III adh_short_C2 Atg8
Motif
Other DBs
NCBI-GeneID: 6628103
NCBI-ProteinID: XP_002052427
FlyBase: FBgn0208855
UniProt: B4LRB2
LinkDB All DBs
Position
Unknown
AA seq 2431 aa AA seqDB search
MPARFAEEVITAEPATHTAPQLDLGGHYAPRQQVLNEEIAITGFSGRLPESSNIEEFKQN
LFDGVDLVNDDPRRWERGLYGLPDRMGKIKQIDLENFDQQFFGVHQKQAECMDPLLRMLL
ELTHEAIIDAGLNPTDLRGSRTGVYIGVSTSETEQHWCCDPDRVNGYGLTGCARAMFANR
ISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKRL
NMLSPDGSCKAFDESGNGYVRSDGCVVLLLQRTSVAKRVYASILNVRTNTDGYKEQGITY
PIGSMQNRLIRETYEEIGLNPNDVVYVEAHGTGTKVGDPQEVNSITDFFCKNRTTPLLIG
SVKSNMGHSEPASGVCSVAKILIAMESGIIPGNLHYNKPNPDLYGLLDGRLKVVDKNMPW
NGGIIGLNSFGFGGANAHVILKSNPKPKTITPRNGGPKVVIASGRTFEAVQQMLESAADH
TDDDEYLHLINDIHSKPIPLHYFRGYSVVSNKGSLQREVVEFSDEKRPIWYIYSGMGSQW
ASMAKDLMNIDVFAKSIQRCADVLKPVGVDLIEVLTRSTDKSFENILNSFISIAAMQVAL
TDLLSSLNIHPAGIVGHSVGELGCAYADGCFTPEQTVLAAYWRGKSILDTQLPKGKMAAV
GLSWDEAHKLVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAQQIFAKAVNSSGYAFH
SKYIADAGPKLRKSLEKIIPNAKNRTERWVSTSIPESAWSTPIAKQSSAAYHVNNLLSPV
LFHEALQHVPKNAISIEIAPHGLLQAILKRALGPDATNLSLVKRGHENNVEFFLSNVGKL
FAAGAQPQVLNLVRPISYPVGRGTPMLNSKVGWDHTQKWLVAKFGKETSSGETIIEIDLS
KEEDAFLAGHNIDGRILFPATGYMALAWMTFAKMRGGEFQKTPVVMENLVFHRATILNKS
AVVKFGINFFDGTGKFEICESGSLAVSGQITIPESIDNEELPLEPQAPSKVAKPLATNDV
YKELRLRGYDYSGIFRGILSSDTYASSGNLQWVDNWVSFMDTMLQFSILSKNLRELYLPT
RIEKAVINPLKHLELIKGLTKVTQTETGLPVYWYNDINVIKSGGVELRGLKASLAQRRPG
TQNPPTLERYCFVANNNATELHENTEKARLHALDVSIQLIIENSGGAVKLKGVELANGRN
PDVLTANHLLQIIEGEPLLTGDVAVVTSNNNEEIIASALGDSGVRVITKDVLKEPVEQNC
HFVFGIDVLARPDTKTLENSIASIRDGGFLIFEEGLTTYVKTGRALLEKFGFVAVQEQTL
GGTRVVVLARRRVDLKTRKSVVVQVTEKNFDWVDELKAALATAATEQQYVYVVCQNEELF
GAVGLMTCIKNENGGKLARLVFVQDLVSEKFALNAPLYQKQLEKDLVSNVLKNGNWGSFR
HLKLETQQATLQVDHAYVNTLVKGDLSSLKWIEGAKIDSTTKKDYETCTVYYAPINFRDV
MLSSGKLAADALPGDLAEQDCVLGLEFAGRDTAGRRVMAMVPAKSLATTCLASKRMMWQI
PEKWTMEEASTVPCVYATVYYALVVRGQMKKGERILIHAGSGGVGQAAISVALHHGLTVF
TTVGSKEKREFLLKRFPKLQARNIGNSRDTSFEQLVMRETKGRGVDLVLNSLSEEKLQAS
IRCLGLNGRFLEIGKFDLSNNSPLGMSVFLKNTSFHGILLDSVMEGEEEMQNQVVSLVAE
GIKSGAVVPLPTSVFNDKQVEQAFRFMASGKHIGKVVIKVRDEEDGKKTLMPKPRLINAI
PRTYMHPEKSYILVGGLGGFGLELTNWLVTRGARYIVLTSRSGVKTGYQGLMIRRWEERG
VKVVIDTNDVTTAAGAKKLLESSNKLALVGGIFNLAAVLRDALIEDQTAKDFKTVADPKV
TATKFLDQYSRTICTELDYFICFSSVSCGRGNIGQTNYGLANSAMERICEQRQVSGFPGT
AIQWGAIGDTGLVLENLGDNDTVIGGTLPQRMPSCLQTIDIFLQQPHPVLASMVVAEKRK
SDQSAGVSLISTISNILGLRDTKNIQDASSLADLGMDSLMGAEIKQTLERNFDIVLSTQE
IRQLTFGALKEMDGGAEVKPTASSADAAVSEPAAKSTPPSRTASPMGDGTQVVFTTALIP
TEEIVRLETQAPANSTQNPIFFIAPIEGFATALALLAKKLEVPAYGLQFTSTVPLDSIEA
AARFYIKQLRTVQAKGPYKLAGYSFGCLLTYVMAAILEETNEIANVVMLDGAPTYVNWYT
SSFKQRYTVDDDNSNQSYGLAYFGLVLANIDYKALVRLLLVIPTWEEKLEKFAELLSVEI
TQPVETIKTAAKLFYKKLELADGYTPKLKLKSKVTLVKPTDNSAKMDEDYRLKEVCIKPV
EVHTVEGNHRTFLIEDQSLVTIQSILKRLFN
NT seq 7296 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccgttttgccgaggaagtgatcaccgctgagcccgcaacgcatactgccccc
caattggacctgggtggtcactatgcgccgcgccagcaggtgctgaatgaggagattgcg
ataactggattctctggccgtctgcctgagagttcaaatatcgaagaattcaagcagaat
ctgttcgatggcgtcgatttggttaatgatgatcccagacgctgggagcgcggtctatat
ggactacccgacaggatgggcaaaatcaagcaaatcgatctggagaatttcgatcagcag
ttctttggcgtgcaccagaagcaagccgagtgcatggatcctttgctgcgcatgctgctc
gagctgactcacgaggcaatcattgatgccggcttaaatcccacagatttgcgcggatct
cgcactggcgtatacattggcgtatcgacatcagaaacagagcagcattggtgctgtgat
cccgaccgtgttaatggctatggcttgacgggctgtgcacgtgccatgtttgccaatcga
atttcatttaccttcgacttcaagggaccaagctacagcattgacacggcctgctccagc
tcgttgtacgcactggaacaggctttctccgatatgcgcgagggcaaggtcgacaatgca
ctggtcgctggcgctggcctcattctcaaacccaccatgtcgctgcagttcaagagactc
aacatgttaagtccggatggcagctgcaaggcgttcgacgagtccggcaacggctatgta
cgctccgatggctgtgtggtgttgcttctgcaacgtacatcggttgccaagcgtgtgtat
gcttccattttgaatgtgcgcacaaacacggacggctacaaggagcaaggcatcacctat
cccattggtagtatgcagaatcgtctaatacgcgagacatacgaagaaattggtcttaat
cccaacgatgtggtatatgtggaagctcacggcaccggcaccaaagttggtgatccacag
gaggttaattccatcactgactttttctgcaagaaccgtaccacgcccctactgattgga
tcggtcaagtcaaacatgggtcactcggagccggcgtccggcgtttgttcggtagccaag
atactgatcgcgatggagtcgggcatcatacccggcaacctgcactacaacaagcccaat
ccggatctgtacggtctgcttgatggtcgtctcaaggtggtcgataagaacatgccatgg
aacggaggcatcattggcctaaattcctttggctttggtggcgctaacgctcacgttatt
ctgaagtccaatcccaagccaaagaccataacaccacgcaacggtggacctaaagttgtg
attgcttccggtcgcaccttcgaggccgtacaacagatgctcgaatctgccgccgaccac
actgacgacgatgaatatctgcacctgattaacgatatacactcaaagcccattccgctg
cactatttccgtggttacagtgtggtgagcaacaaaggatcgctacagcgcgaggtggtg
gagttcagcgacgaaaaacgccccatatggtacatctattcgggcatgggcagccaatgg
gccagcatggcgaaggatctgatgaatatcgatgtgtttgccaagagcattcaacgctgc
gccgatgttctaaagcccgtgggcgtggatttaattgaagtgctaacacggtcaacggat
aagagctttgagaacattctcaattcgtttatctcgattgccgccatgcaggtggccctg
acggacctacttagctcactaaatatccatccggctggcattgtgggacattcggtgggc
gaactgggctgtgcctatgctgacggctgctttacgcccgaacagaccgtgttggctgcc
tactggcgaggcaagagcatcctggatacgcagttgccaaagggcaagatggctgcagtg
ggtctcagctgggatgaggcgcacaagctcgtgcccagtgattgcttccccgtctgccac
aatagcgaagacaattgcacaatttcgggaccggaggcatccatcgaagcgctggtggcc
aaacttaatgctcagcaaatattcgccaaagctgttaacagcagcggctatgcattccac
agcaagtacatcgccgatgcaggtcccaagctgcgcaagagcctggagaagattatacct
aatgccaagaaccgtaccgaacgttgggtgagcactagtattcccgaatcggcctggagc
accccgattgcaaagcaatcatcagctgcctaccacgtgaacaatctgctatcccctgta
ctctttcacgaggctttgcaacacgtccccaagaatgccatttccattgaaatcgcacca
cacggcctactgcaggccatactgaagcgcgcccttggcccggatgccaccaacttgagc
ttggtaaaacgcggacacgaaaacaatgtggaattcttcctgagcaacgtgggaaagctg
tttgcggctggagctcagccgcaggtgctgaatctggtgcgtcccatcagctatcctgtt
ggtcgcggcactccaatgctgaactcaaaggtcggctgggatcacacgcagaagtggttg
gtggccaagtttggcaaggagacctcttcgggtgaaaccatcatcgagatcgatctctcc
aaggaggaggacgcattcctagctggccataatatcgacggacgcattctgtttccggct
accgggtatatggccttggcctggatgacgtttgccaaaatgcgaggtggcgagttccaa
aagacgccagttgtcatggaaaatctggtattccaccgtgcaactattctgaacaagagc
gccgtggtcaagttcggcataaactttttcgatggcactggcaagtttgagatctgtgaa
agcggcagcttggccgtttccggccagatcacaattccggagagcatcgataacgaggaa
ctgcccttggaaccccaggcgcccagcaaggtagccaagccgctggccaccaacgatgtc
tacaaagagttgcgcctgcgcggctacgattacagcggaattttccgcggtattttgagc
tccgatacctatgcttccagtggtaatttgcagtgggtggacaattgggttagcttcatg
gataccatgcttcagttcagcattctaagcaagaacctacgcgaactgtacttgcccacg
cgcatagagaaggccgtcatcaatccactcaagcatttggagctaattaagggactcact
aaggtaacacaaacagagactggtctgccggtctactggtataatgatattaatgttatc
aagagtggcggagttgagctacgcggtctcaaagcctcgctggcacagcgtcgcccgggc
acccagaacccacccacacttgaacgctactgctttgtggccaacaacaatgcaaccgaa
ttgcatgagaatacggaaaaggcacgtttacacgctctggacgtgtccattcagctaatc
attgagaactccggtggtgctgtcaaattgaagggtgtcgagctggccaatggccgtaat
cccgatgtgctcacggccaatcatttgctgcaaattattgaaggcgaaccgttgctaacc
ggcgatgtggccgtggttacatccaacaacaatgaggagattatcgcgagcgccctaggc
gattctggtgtacgcgtcataaccaaggatgtgcttaaggagccggttgaacagaattgc
cactttgtattcggcatcgatgtgctcgcccgaccggatacaaagactctcgaaaatagc
attgccagcattcgtgatggcggttttctcatctttgaggaaggtctgactacgtatgtc
aagactggacgcgcacttctcgaaaagttcggcttcgttgccgtgcaagagcagacgctg
ggtggcacacgcgttgtcgtactggcacgccgtcgagtcgatctgaagacgcgcaaatct
gtggtcgtgcaggtcacagagaagaactttgattgggtcgatgaacttaaggctgcgctg
gccacagcggccacggagcaacaatatgtctatgtggtctgccagaatgaggaactgttt
ggtgctgtcggtctgatgacatgcatcaagaatgagaacggcggtaagctggcacgtttg
gtattcgtacaggatcttgtatccgagaagtttgcactcaacgcgccgctgtaccaaaag
cagctggaaaaggatctggtttcgaatgtacttaagaacggcaactggggtagcttccgt
catctgaaactggagacccaacaggccaccctacaggtcgatcatgcctatgttaatact
ctagtcaaaggcgacttgtcctctctgaagtggatcgagggtgccaagatcgatagcaca
accaaaaaagactatgaaacctgcaccgtttattatgcgcccattaacttccgtgacgtg
atgctgtcttcgggtaaactggccgcggatgctctgcctggtgacctggccgagcaggat
tgcgttttgggcttggagtttgccggccgagataccgccggacgccgggtaatggccatg
gtaccggcaaaatctttagcaactacttgcctggccagcaagcgcatgatgtggcaaata
cccgaaaagtggaccatggaggaggcctccacggtgccctgtgtctacgctaccgtatac
tatgcccttgtcgtgcgcgggcaaatgaagaagggtgagcgcatccttatccatgccggc
tcgggcggtgtgggccaggctgccatttctgtggccctgcaccacggtctgacggtcttc
accacggtcggcagcaaggagaaacgtgaatttttactgaagcgttttcccaagctgcag
gcacgtaacattggcaattcacgtgacacatcgtttgagcaattggttatgcgcgaaaca
aagggacgcggtgtcgatcttgtactgaactcactgtccgaggagaagcttcaggcatct
atacgctgcttgggtctcaatggacgtttcctggagattggcaaatttgatctgagcaac
aacagtccattgggcatgtcggtgttcctgaagaacacatcgttccatggtattctgctc
gacagcgtaatggagggcgaagaggaaatgcagaaccaagtggtatcactcgtagccgag
ggaatcaaaagcggcgctgttgtacctttgcccacatccgtgtttaatgacaaacaagtg
gagcaggccttccgtttcatggcgtcaggcaagcacatcggcaaggtggtcattaaggtg
cgcgatgaagaggatggcaagaagacgctaatgcccaagccgcgtctgatcaacgctatt
ccccgcacctacatgcatccggaaaagagttatatacttgttggtggcctaggcggtttt
ggcttggagctaaccaactggctggttacacgaggagcacgctatattgtgctcacctcg
cgctcgggcgttaagaccggctatcagggtctaatgatacgtcgctgggaggagcgcggc
gttaaagtggtaatcgatactaacgatgtgactacggctgcgggagccaagaaattactg
gaaagcagcaacaaattggcactggtcggaggtatatttaatttggctgccgtgctgcgg
gatgcgctgattgaggatcagacagccaaggactttaagaccgttgcggatcctaaggtg
acagccacaaaattcttggaccaatattcgcgcaccatttgcacggagctcgactacttt
atctgcttttcgagcgtctcatgcggtcgcggcaacattggacaaactaactacggcctg
gcgaactccgccatggagcgcatttgtgaacaacgccaagttagcggattccccggcaca
gccatacaatggggcgccattggcgacactggcttggtgctagagaatctcggcgataac
gatactgttattggaggcacactgccgcagcgcatgccgtcctgtctgcagaccatcgac
atattcctgcagcagccacatcctgtattggcgtccatggtggtggccgagaagcgcaag
tcggatcagtccgccggtgttagtcttatttcaaccatatcgaatatcttgggactgcgt
gacaccaaaaacattcaagacgcctcttctctagccgatttgggcatggactccctaatg
ggagcggaaatcaagcaaacactggagcgcaactttgatattgttctctcgacgcaggag
attcgtcaactaacttttggagctctcaaagaaatggacggcggcgccgaggtgaagccc
actgcaagctcagctgatgcggctgtcagtgaaccggctgccaagtccacgcctccatcg
cgaacagccagtcccatgggagatggtacacaggtggttttcaccactgcactgataccc
acagaggaaattgtgcgcctggagactcaggcaccggcaaatagcacacagaatccgata
ttctttattgccccaattgaaggatttgccacagcgctggcattgttggccaagaagctc
gaggtgcctgcctacggcttgcaattcaccagcaccgtgcccttagactccatagaggca
gcagcgagattctatatcaaacagttgcgtacggtgcaggcaaagggaccctacaaactg
gcaggctactcctttggctgtctgctcacctacgtaatggccgccatactggaggagacc
aacgaaattgccaatgttgtcatgctggatggcgcgcccacctacgtcaattggtatacg
agcagctttaagcagcgatacaccgtcgatgacgacaacagcaaccaaagctacggcctg
gcctacttcggtcttgtgctggccaacattgactataaagctctggtacgtttgctactg
gtgatacccacctgggaggagaaactagaaaagtttgctgagcttctgagtgtggaaata
acccagccggtggagactatcaaaacggctgcgaaactcttttacaagaagctggagctg
gccgacggctatacgccaaaattgaaactcaagtcaaaggtgacattggtgaagcccaca
gataactctgctaaaatggatgaggactatcgccttaaggaggtttgcataaagcccgtg
gaagtgcacactgtcgaaggcaatcatcgtacattccttatagaggatcagtccctggtg
acaattcagagtatacttaagcgactcttcaactag

DBGET integrated database retrieval system