KEGG   Drosophila virilis: Dvir_GJ22359Help
Entry
Dvir_GJ22359      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20283  golgin subfamily A member 4
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dvi04131]
    Dvir_GJ22359
Membrane trafficking [BR:dvi04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    Dvir_GJ22359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRIP
Motif
Other DBs
NCBI-GeneID: 6626638
NCBI-ProteinID: XP_002050815
FlyBase: FBgn0209472
UniProt: B4LMB3
LinkDB All DBs
Position
Unknown
AA seq 1487 aa AA seqDB search
MFANLKNKLIEEVKASPSKFQQFANAAQAAVSSSSSTTTPNSSENTDTGTNENFFSITEE
DTPQNSPYRLQKLPRYGRASTQSLNGMGGSGAIPRTRKLSNSSMASDVSFRLPTYDAPPT
YHLQSDLDETSSEFDDSASTARLDVITKDQLYDAYKKSLDRYHKYRCRYTDLAKKYKELE
RDSSKARSVLVETQDKALRRISELREQCTLEQQAKAHLEEALRIEMDDMSCKMQAYQTKL
KLLGENPDNVTAALERGQADKLIDLEEPIIVPESAPTANGSQPAQELDEELAKLRQSLAE
HEAQLKQLSKTNEEANSTIAALRKQEEENVLLLAQTKQAIHTELEHKEAEVRQLQEKVKQ
LEIELDTANGRETQSVDIKEQLKKLQSAKQEVDAKLIATEHVLSTLRVEHTEKEQQQKKI
ESELASKGKELQQLQEQLKQQEAELAQATSRESQAKDIEEQLKTLQNAKQEAEAKLAATE
LELNALKNNQEAEQQQVASQLAKTTAELAQRESKLQQLEEQLKQQEAELQMANSRETQVE
AVKEQLLQLQNAKQAAEAQLLTTEQLLNTLRLEHTEKEQLAASQEKQLQSKLEHKENELC
QLQEQLTKLKAELETANSQDELNEQLHNAQQAADAQLLAMEQQLNTLKNEQAAKEQQVDA
LQEQLRTLKTDSEQSLQDLRLHNTQLNEIVQRYQQNESSLDELQSQLEDARVRLREQEQR
VLETEKSLEVEQEMVAALSAEKSAAEEQTLKLQRELQALSDQYASSNKSESEATAALRLQ
IEALNEQVTAAQAGTLAKEKELKAVANKLNKLKKQHEQLQAKHSEQGVSLEQLKAEAVNA
EQLRREKQELQERVNVILEEITTMQAHVQEVQAAQTQLEREKQQLETHIEALQQQQQERD
AQGEQSSARLEEIERENSKLAEHNCLLQEQNNHLQKQQDELNRLQNKLQQVLDEHSKLQN
AQEIMEHDHRTLQDKCDAYEKENLIAKDELKCLQQEKDALEAQRSSLQLDLDQAQQQLSE
VRERQRELEQHLAEQTQRCTELEASNEQVATLQATVHNLREQLDSFKETEKAMLEKAQAA
SINHAAQLETLEARWSAANGDVQRLHEANDALQREIETLKNSTHEKSAYEQLQIENEYLN
KHTKQLEMELSQALTSHGDSGEKLKSLQCELYVLQEQVLQHASQLAEKDSDAAAAKAEAA
QLKSALEEQAIELTRQVEHAKFVSEQNDTVQKELLQSQQQLQERQAELSKAQERCLSLEE
QLDKQQSEQDKEQAKPAATLSNDSEHLRSLNEQLQRELEDLKHKSNGEQTNLQQEIDELQ
ANNKEMTERITELETLRAGIQAQQLLASLAPKSVQQAAANDEKAQLESKLKDIMNEVQDV
TNRNLFLEQKCENFLILEQSNERLKLQNAKLSRQLDETLVSMQHSDSVPANTEFEYLRNI
MFQYLTGNTNNETLVKVISAVLKFSPQQAQVALEKEHQRRSLLNKLI
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccaatctgaaaaataaactcatcgaggaggtgaaagcgtcgccgtccaaattc
caacaatttgcaaatgcagcccaggccgccgtgagctcatcgtccagcacaacaacaccg
aacagctcggagaataccgacaccggcaccaatgagaatttcttcagcatcacggaagag
gacacgccacaaaactcgccttaccgcctacagaagttgccgcgctacggacgtgcttcg
acccagtctctgaatggcatgggcggcagcggagccataccgcgcacccgcaagctatcg
aactcgtccatggcaagcgatgtctcgtttcgcctgcccacctatgatgcgccaccgacg
tatcacttgcaatcggatttggatgagacgagcagcgaatttgatgactccgcatcgacg
gcacgcctggatgttatcactaaagatcagctatacgatgcgtataagaaatcgctcgac
cgctatcataaataccgctgccgttacacggatctggccaagaagtacaaggaactggag
cgagacagcagcaaggcgaggtctgtgcttgtggagacgcaggataaagcgctgcgtcgc
atcagcgagttgcgtgaacaatgcaccctggagcagcaggcgaaggcacatctggaggaa
gctttgcgcatcgaaatggatgacatgagctgcaagatgcaggcctaccaaaccaagctg
aagctactaggcgagaatccggataacgtgaccgccgcactggagcgcggccaggcggac
aagctgattgatcttgaggagccaataatagttcctgagtcagcgccaactgcaaatggc
agtcaacctgcacaggagctggacgaagaactggcgaagcttaggcaatcgctggccgaa
catgaggcacagttaaagcagctgagcaaaaccaatgaggaggccaacagcacaattgct
gcgctgcgtaagcaggaggaagagaatgtgctgttgctggcacagaccaaacaagctata
cacactgagctggagcataaggaagccgaagtgcgccaactgcaggagaaggttaagcag
ctagaaattgaattggacacggccaatggcagggaaacgcagtcggttgacatcaaggag
caacttaagaaactacaaagcgccaaacaggaagttgacgctaaactcattgcaacggag
catgtgctaagcacactgagagtggagcacacggaaaaggagcaacagcaaaaaaaaata
gagtccgagctggccagcaaaggcaaggagctgcagcagttgcaggagcagttgaagcaa
caagaagctgagctggctcaggcaaccagtcgtgaatcgcaggcaaaggacatcgaggaa
cagctgaagacgctgcagaatgccaaacaagaggcagaagcaaaacttgctgcaacagaa
ctagaattaaatgctctcaaaaataaccaagaagcagaacaacagcaagtggcatcgcag
cttgcgaaaacgacagctgaactggcgcaaagagaaagcaaactgcagcagttggaggag
cagttaaaacagcaagaagccgagttgcaaatggccaacagtcgggagacgcaagtcgaa
gctgtcaaagaacaattattgcagctgcaaaatgccaaacaggcagcggaggctcagttg
cttacaacggagcaattgttaaatacactgagattagagcacacggaaaaggagcaactg
gcagcgtcgcaggaaaagcagctgcagtccaagctggaacataaggagaatgaactgtgc
caattgcaggagcagcttacaaaactaaaagcagagctcgaaaccgccaattctcaagac
gagctcaatgagcagctgcacaacgcccaacaggcagcagatgcccagctgctggccatg
gaacaacagctgaacacactgaaaaacgagcaggcggcaaaggagcaacaggtggatgcg
ctgcaggagcaactgcgcacgctgaaaacggacagcgagcagagtttgcaggacttgcgc
ctgcataacactcagctgaatgaaattgtacagcgctatcagcaaaatgagtcgagcttg
gatgagctgcagagtcagctagaagacgcccgagttcgactgagggagcaggagcagcgt
gtgcttgaaactgaaaagagcctggaagtcgagcaggaaatggttgccgcactcagcgct
gaaaaatcagcagctgaggaacagacgctcaagctgcagcgtgagctgcaagccctaagc
gatcaatacgccagcagcaataagagtgagtcggaggcgacggcagctttaaggttgcag
atcgaagcgctcaacgaacaggtgactgctgctcaggccggcacgctggccaaggaaaag
gagctaaaggcggtcgcaaacaaactaaacaagctgaaaaagcaacacgagcagctgcag
gcaaagcatagcgagcaaggcgtcagcctggagcagctcaaggcagaggcggtgaacgca
gaacagctgcggcgcgagaagcaagagctgcaggagcgcgtcaatgtcatactcgaggag
ataacaaccatgcaggcccatgtgcaggaagtgcaggctgcacagacgcaactggagcgc
gaaaagcagcaattggaaacacacattgaggcactgcagcaacagcagcaggaacgcgat
gcgcagggtgagcagtcgtcggccaggcttgaggagattgagcgcgagaatagcaaactg
gccgagcataactgtctgctgcaggagcaaaataatcacttgcagaaacaacaggacgag
ctcaacaggttgcagaacaaattgcagcaggtgctcgatgagcactccaagctgcaaaat
gcgcaggagattatggagcatgatcatcgcacgctgcaggacaaatgcgatgcctatgaa
aaggaaaatctcatagcaaaggatgaactcaaatgcctgcaacaagaaaaggatgcctta
gaggcgcaaagaagtagcttgcagcttgacctggatcaagcacagcaacagctgtcagag
gtgcgcgagcgacaacgcgaactggagcagcacctggcagagcagacgcaacgctgcact
gagctggaggccagcaatgagcaggtggccacactccaggcaaccgtccacaatttacgc
gagcagctggactcatttaaagagacggagaaggccatgctcgaaaaagctcaagctgcc
agcattaaccatgcagcgcagctggaaacgctggaggcacgttggagtgctgccaatggg
gatgtgcagcgactgcacgaggcgaacgacgcgctgcagcgggaaatcgagacgctgaag
aactccacgcatgagaagtccgcatacgaacagctacaaatcgaaaatgaatacctaaac
aaacataccaaacaactggaaatggaactctcgcaggcgttgacctcgcacggcgacagc
ggcgagaaactgaagtctctgcaatgtgagttgtacgtgctgcaggagcaggtcttgcag
catgccagccagctggccgagaaggactccgacgccgccgcagccaaggcggaggcggcg
caactgaagtccgcgctggaggagcaagcaatagagttgacacgccaggtggagcatgcc
aaatttgtcagcgaacaaaatgacacggtacaaaaggagctattgcagtcacagcaacaa
ctgcaggaacgccaagctgagctgtcgaaagcgcaagagcgctgtcttagcctcgaagag
caactggacaagcagcagagtgagcaggataaggaacaggcaaagccagcagcaacactg
tccaacgattccgagcatttgcgcagcctcaacgagcagctgcaacgcgagctggaggat
ctgaagcataaaagcaacggggagcagacaaatctgcagcaggaaatcgatgagttgcag
gccaataacaaagaaatgacggaacgcatcacggaactggaaacgttacgtgccggcata
caggcacagcagctgttggccagcctggcgcccaaaagcgtccagcaggcagctgccaac
gatgagaaagcccagctggagtcaaaactgaaagacatcatgaacgaggtgcaggatgtg
accaatcggaacctgtttctcgaacaaaagtgcgaaaactttctcatactcgagcaatcc
aatgagcgtctgaagctgcaaaacgccaaactatcgcggcaattggatgaaacactggta
tccatgcagcatagcgacagcgtgccagctaacacggaattcgagtatctgcgcaacatc
atgttccagtatttgaccgggaatacaaacaacgaaactttggttaaagtcatatcggca
gtgctgaaattttcgccccagcaggcacaggttgccctcgaaaaggagcaccagcggcgc
tcactactaaataaactgatctag

DBGET integrated database retrieval system