KEGG   Drosophila virilis: Dvir_GJ23870Help
Entry
Dvir_GJ23870      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dvi  Drosophila virilis
Pathway
dvi00010  Glycolysis / Gluconeogenesis
dvi00051  Fructose and mannose metabolism
dvi00052  Galactose metabolism
dvi00500  Starch and sucrose metabolism
dvi00520  Amino sugar and nucleotide sugar metabolism
dvi01100  Metabolic pathways
dvi01200  Carbon metabolism
Module
dvi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dvi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ23870
   00051 Fructose and mannose metabolism
    Dvir_GJ23870
   00052 Galactose metabolism
    Dvir_GJ23870
   00500 Starch and sucrose metabolism
    Dvir_GJ23870
   00520 Amino sugar and nucleotide sugar metabolism
    Dvir_GJ23870
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dvir_GJ23870
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dvir_GJ23870
Membrane trafficking [BR:dvi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dvir_GJ23870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 6630262
NCBI-ProteinID: XP_002053421
FlyBase: FBgn0210965
UniProt: B4LYE5
LinkDB All DBs
Position
Unknown
AA seq 450 aa AA seqDB search
MSDPKQKYPEAYEICEKFMLNKQHMDEIVNRLTKEINMGLTRDTHPRATVKCFVTYVQEL
PTGNERGKYLALDLGGTNFRVLLVNLINDRDIDITGKTYAISKELQEGSGIKLFDFIARC
LAEFCKEHKMEQSNTPLGFTFSFPCKQVGIDNGTLVAWTKGFKAEGVVNQNVVELLRDAI
KRRGDFKVNVVAILNDTTGTLMSCAFNHRNCKIGMIVGTGSNACYVEKTANTQTFDGYLS
STKPNMIINCEWGAFGDNGVLDFIRTSYDHEVDKQSINPKKQIFEKCISGMYMGELVRLV
LLELMEKEAIFKGQTSQSILIKGKFDTSFITEIESDQPGSHRNAALVMDRLGIRTNNEKD
LGCLRFICETISTRSARLAACGLVCLINKMNVKDLTVGIDGSVYRYHPNYHRLLTENMNM
LLKGSVKFELVLSEDGSGRGAALIAAVCAK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatccaaagcagaagtatccggaggcctatgagatatgcgagaagttcatgtta
aataaacaacacatggacgagattgttaatcgtctaaccaaggaaatcaatatgggtctc
acacgggatacacatccgagggccaccgttaagtgctttgtcacttacgtacaggagctg
cccacgggaaatgagcggggaaagtatctggcgctggatctgggcggtaccaattttcga
gtcctcttggttaatctgattaatgacagagatattgatattaccggaaagacttatgcc
attagcaaggaattacaggaaggttcgggcataaaactgtttgactttattgccagatgt
ctagcggaattttgcaaggagcataaaatggagcagtctaatacaccattgggatttacc
ttttcctttccatgcaaacaagttggcattgataacggcaccttggtcgcgtggacgaag
ggtttcaaagccgagggagttgttaatcagaacgtggtcgaattgctgcgggatgcaatc
aagcgtcgaggcgacttcaaggtcaatgtcgtggccatattgaacgatacgacgggaacc
ctaatgtcctgtgcatttaaccaccgcaattgcaaaattggcatgattgttggcacgggc
agtaacgcttgctatgtggagaagacggcgaatacccaaaccttcgatggctatctaagc
tccacaaagcccaatatgatcatcaattgcgaatggggtgcttttggcgacaatggcgtg
ttggatttcatacgcacttcctatgatcatgaagtcgacaagcagtcgatcaatccaaag
aagcagatattcgagaagtgcatctctggcatgtacatgggcgaattggtgcgtctcgtt
ctattggaattgatggaaaaggaagccattttcaagggccaaacatcgcaaagcattcta
ataaagggcaagtttgatactagctttataactgagattgagtccgatcagccgggctcg
catcgcaatgccgcactggtgatggatcgcctgggcatcagaacgaataatgagaaggat
ctgggatgtttgcgctttatatgcgagactatatccacgcgttccgcaaggctggctgcc
tgtgggctcgtctgcctgatcaacaaaatgaatgttaaggacttgactgtcggcattgat
ggcagtgtatatcggtatcatccaaattaccatagactgttaacggaaaatatgaacatg
ctgctaaagggttcagtcaaatttgagctagttttatccgaagatggctcgggtcgcggt
gcggctctaattgctgcggtgtgcgctaagtga

DBGET integrated database retrieval system