KEGG   Desulfovibrio vulgaris DP4: Dvul_0254Help
Entry
Dvul_0254         CDS       T00452                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00564  Glycerophospholipid metabolism
dvl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dvul_0254
Enzymes [BR:dvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dvul_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA Pyr_redox_2 NAD_binding_8 Pyr_redox HI0933_like Pyr_redox_3 Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABM27278
UniProt: A0A0H3A751
LinkDB All DBs
Position
complement(312298..313938)
Genome map
AA seq 546 aa AA seqDB search
MSRRQILERLQADKTFDLLIVGGGATGCGVALDAATRGLDVALVERDDFAQGTSSKSTKL
VHGGVRYLEKAILKADKEQFALVHEGLRERGYLLRNAPHLAHPVQLMTPVDSWKDAAYLF
AGLTMYDLLAGRLGLGHSRFVTRSKAQRLFPTLRLGKAKGAVLYYDGQFNDARMAVTLAR
TAALHGATCANHVEVIDLVRENGRLCGAVLRDVSSGETWHVRARGIINATGPFSDGLRRM
DDQNACDILKVSSGIHLVIDPGHTPPHLGLMVPRTDDGRVLFMIPWQGHVVFGTTDEPVD
ISRDPVPTQEDIDYLLNYAGRYLSRPLSRDDVRAAWCGLRPLVFEADKSCTQELARTHVI
EVSPGGLLTITGGKWTSYRRMAEDTIDRADAAFELGLQRPCVTRDLRVIGSRGFVRGAHA
EMARDFGVDPALARGLFELHGDETPLILTLAREEGLMDRLHPAHNYIGAQVAFAVRHEMA
VHLTDVMVRRLPLGLVDVQHTLEASAPAADIMAQELGWDAATRQREMEALAAYLAAWRPA
PDAATT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacgacagattctggaacgcctgcaggccgacaagacgttcgacctgctcatt
gtcggaggcggggccaccggctgtggcgtcgccctcgacgcggccacgcgcggactggac
gtggcactggtggagagggacgacttcgcacaaggcaccagtagcaagagcaccaaactc
gtccacgggggggtgcgctaccttgagaaggccatcctcaaggcagacaaggaacagttc
gcactcgtgcacgaaggtcttcgcgaacggggctacctcttgcgcaacgcgccccacctc
gcccaccccgtgcaactcatgacgccggtcgattcatggaaggacgcggcctatctcttt
gcgggcctcaccatgtacgacctgctggcaggtcgcctcgggctgggacacagtcgcttc
gtcacccggtccaaggcccagcgcctcttcccgaccttgcgcctcggaaaggccaagggg
gcggtcctctactacgacgggcagttcaacgatgcgcgcatggccgtcaccctcgcccgc
acggcagccctccacggcgcgacctgcgccaaccacgtcgaggtcatcgaccttgtgcgc
gagaacggacgcctttgcggtgccgtcttgcgcgatgtgagcagcggcgagacgtggcat
gtacgggcgcggggcatcatcaacgccaccggccccttcagcgacggccttcgccgcatg
gacgaccagaatgcctgcgacatcctcaaggtgagttcgggcatccatctggtcatcgac
cccgggcacaccccgccccatctcggcctcatggtcccccgcaccgatgacggacgcgtc
ctgttcatgattccgtggcaggggcatgtggtcttcggcaccaccgacgaaccggtggac
atctcgcgcgaccctgtgcccacacaggaggacatcgactacctgctgaactatgccgga
cgctacctgtcgcgccccctttcgcgcgatgacgttcgcgcggcgtggtgcggcctgcgc
ccgctcgtgttcgaggccgacaaatcgtgcacacaggaacttgcgcgcacccatgtcatc
gaagtctcgcccggagggctgctcaccatcaccggcggcaagtggaccagctacaggcgc
atggccgaagacaccatcgacagggcggacgcagccttcgaactggggctgcagcggcct
tgcgtcacgcgcgacctcagggtcatcggttcacgggggttcgtgcgcggagcccatgcc
gagatggcacgcgatttcggtgtagaccctgcccttgcccgcgggcttttcgaactccat
ggcgacgagaccccgctcatcctcacccttgcccgcgaagaggggctgatggaccgcctg
cacccggcgcacaactacatcggggcgcaagtggccttcgccgtgcgccacgagatggcg
gtgcacctcaccgacgtcatggtccgcagacttccgctgggtctggtcgatgtgcagcac
acccttgaggcatctgccccggctgcggacatcatggcgcaggaactgggctgggatgca
gcaacccgccagcgcgagatggaggcccttgccgcctacctcgccgcatggcgacccgcc
cctgacgccgccacgacatga

DBGET integrated database retrieval system