KEGG   Desulfovibrio vulgaris DP4: Dvul_0599Help
Entry
Dvul_0599         CDS       T00452                                 

Definition
(GenBank) penicillin-binding protein 6, Serine peptidase, MEROPS family S11
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00550  Peptidoglycan biosynthesis
dvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dvul_0599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dvl01002]
    Dvul_0599
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dvl01011]
    Dvul_0599
Enzymes [BR:dvl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dvul_0599
Peptidases [BR:dvl01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Dvul_0599
Peptidoglycan biosynthesis and degradation proteins [BR:dvl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Dvul_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABM27622
UniProt: A0A0H3A6C9
LinkDB All DBs
Position
complement(753839..755164)
Genome map
AA seq 441 aa AA seqDB search
MAHQSIPGHGKRFPGQLGIVLLVLTFVVASVCGAHASERLNVVSAFLIDQNSRRVLFEQN
ADAQIPPASLTKVISMYVALDHIRAGKASLADKVKISARAARTGGSRMFLTRGETVSLDE
LLMGMAVSSGNDASVAVAEHIAGSTDRFVQLMNAKARALGMTETTFRNVNGLPAAGQKTT
ARDMGKLAVNYLTAHPQALRYHSTRFIRHNKVITTNKNPMLGNCEGADGLKTGWVCASGY
NLISTVKRGNTRLVAVVLGAENSQVRGQEMNRLIDAGYRSLRGEGPSVAAVLPRLSPADY
RIDLHKTNSLAYAEVSKHKKKIAARKGKLRAGKTGSKQHASAQVSKSSKSSKAVKGKSPD
KSAATSKAVATVRREKAKAVPSNKSVRATKVQQARKAAVARKTETKTTVKRSKPATAAST
KKTAAPPRTPVQRAERTDKRG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccagagcatccccggacatggcaaacgctttcccggccagctaggcatcgtc
cttctggtgctgactttcgttgtggcaagcgtctgcggggcacatgcctccgaaaggctc
aatgtggtatcggcgttcctgatagaccagaacagccgacgtgtgctcttcgaacagaac
gctgacgcgcagattcctcccgcttcgctcaccaaggtcatatcgatgtatgtggccctc
gaccatatcagggccggaaaggcctctctcgcagacaaggtcaagatcagcgcccgtgcg
gcccgaacaggcggttctcgcatgtttctcacccgcggagagactgtatcgcttgacgaa
ctgcttatgggcatggctgtatcctctggcaatgacgccagtgttgcagtggctgagcat
atcgcgggcagtaccgaccggttcgtacaactgatgaacgccaaggcacgtgcactgggg
atgacggaaacgacattccgcaacgtcaacggactgcctgcagcggggcagaagacgaca
gcgcgagacatgggcaagctggcagtcaactatctcactgcccatccgcaggcactgcgc
taccattcaacgcgcttcatcagacacaacaaggtcatcacgaccaacaagaatcccatg
ctcggcaactgcgaaggggccgacggcctcaagaccggctgggtatgcgcgtcgggctac
aacctcatatccactgtcaaacggggcaacacccgccttgttgctgtcgtcctcggcgcg
gagaacagtcaggtgcgcggtcaggagatgaacaggctcatcgacgcaggctacaggtcg
ttacggggtgaggggccttcagtggctgccgtcctgccccgcctctcgcctgccgattat
cggatcgacctgcacaagaccaactctctcgcctatgccgaagtgagcaaacacaagaag
aagatcgcagcccgcaaaggcaaactgcgggcaggcaagactggctccaagcagcacgcc
tcggcgcaggtcagcaagtcctccaaatcatccaaggccgtcaaaggcaaatctccggac
aagtctgcagctacatccaaggctgtcgccacagtgcggcgagagaaagccaaggcggtt
ccttcgaacaagtctgtccgggctaccaaggtgcagcaggcccgcaaggctgccgtcgcc
cgcaagacagagacgaaaacgaccgtgaaacggtccaagcccgccaccgccgcttcgacc
aagaagacggcagcaccgcctcgtactcccgtacagcgcgccgaacgcacagacaaacgg
ggctag

DBGET integrated database retrieval system