KEGG   Desulfovibrio vulgaris DP4: Dvul_0731Help
Entry
Dvul_0731         CDS       T00452                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00010  Glycolysis / Gluconeogenesis
dvl00230  Purine metabolism
dvl00620  Pyruvate metabolism
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
dvl01130  Biosynthesis of antibiotics
dvl01200  Carbon metabolism
dvl01230  Biosynthesis of amino acids
Module
dvl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dvl_M00002  Glycolysis, core module involving three-carbon compounds
dvl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
dvl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_0731
   00620 Pyruvate metabolism
    Dvul_0731
  Nucleotide metabolism
   00230 Purine metabolism
    Dvul_0731
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Dvul_0731
Membrane trafficking [BR:dvl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dvul_0731
Exosome [BR:dvl04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dvul_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABM27754
UniProt: A0A0H3A8E6
LinkDB All DBs
Position
complement(895323..896732)
Genome map
AA seq 469 aa AA seqDB search
MRTKIIATIGPASRSHEVLSRLVNAGVGIFRLNFSHGDASMFVELIGLLRELERESGRPL
TILQDLSGPKIRIGEIAKGALSVSKGDRLLLGPAPAPADNRPFIPFDHPAVLAEFEIGDR
VVLSDGGLQFRVVDKGPNGTFELEANNNGMITSRKGLALPGKSVKLAALTAKDRKDLADG
LALGVDAVALSYVQTPDDIRDAKEIIRAAGRNIPVIAKLERQNAVDRLDEILAETDIVMV
ARGDLGVECPLPELPAMQKRIIRACNRAAKPVIVATQMLLSMVNSPSPTRAETTDVANAV
LDGADCVMLSEETAMGSFPVETVNFMKEIAMKAEELHFELQRLREPDVGRGSADFLAYSA
CLLAEKANADAIVSHSLSGSSARLISSRRPQQPVYAITPDPAAQRWLNFSWGVFPEGGDE
GISGHLERAEAFIERCPDIPDGADVVITAGQPKPGDTPRGTNLVKIYRK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaagattatcgccaccatcggccccgcctcccgttcgcacgaagtcctttca
cgcctcgtcaatgcaggcgtgggcatcttccgcctcaacttctcgcatggcgacgcatcc
atgttcgtggagctcatcgggcttctgcgcgaactggagcgtgagagcgggcgcccgctc
accatcctgcaagacctttctggcccgaagatacggataggcgaaatcgccaagggcgcg
ctctccgtctccaagggtgacaggctcctgctggggcccgcccctgcccccgccgacaac
cgccccttcattcccttcgaccatcccgccgtactcgccgagttcgagatcggcgacagg
gtggtgctctccgacggcgggctgcagttccgtgtcgtggacaaggggccgaacggcact
ttcgaactcgaggccaacaacaacggcatgatcacctcgcgcaagggcctcgccctgccg
ggcaagtcggtcaagctcgccgcgctcacggccaaggaccgcaaagaccttgccgacggc
ctcgccctcggggtcgacgccgtggcgctctcctacgtgcagacccccgacgacatccgc
gacgccaaggagatcatccgcgcagcgggccgcaacatccccgtcatcgccaagcttgaa
aggcagaacgccgtggacaggctcgacgagatactcgccgagaccgacatcgtcatggtc
gcccgcggcgacctcggcgtggagtgcccgctgcccgaactgcccgccatgcagaagcgc
atcatccgagcctgcaaccgtgcggcaaagcccgtcatcgtggcgacgcagatgctcctc
tccatggtcaacagcccctcgcccacacgcgccgagaccacagacgtggccaacgcagtg
ctggacggtgccgactgcgtgatgctctccgaagagacggccatgggcagcttcccggtg
gagaccgtcaatttcatgaaggaaatcgccatgaaggccgaagagctgcacttcgaattg
cagcgtcttcgtgagcccgacgtgggacgcggttcggccgacttcctcgcctactccgcc
tgcctgctggctgagaaggccaacgccgatgccatcgtctcgcacagcctgagcggcagt
tcggcgcggctcatctcctcgcgcaggccgcagcagccggtctatgccatcacgcctgac
ccggcagcccagcgctggctcaacttctcgtggggcgtgttccccgaggggggcgacgaa
ggcataagcggacaccttgagcgtgcagaggcgttcatcgaacgctgcccggacatcccc
gatggggccgacgtggtcatcaccgccggacagccgaagccgggcgacaccccgcgcggc
accaatctggtcaagatttacaggaaatag

DBGET integrated database retrieval system