KEGG   Desulfovibrio vulgaris DP4: Dvul_0912Help
Entry
Dvul_0912         CDS       T00452                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00500  Starch and sucrose metabolism
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dvul_0912
Enzymes [BR:dvl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dvul_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glycos_transf_1 DUF3416 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ABM27933
UniProt: A0A0H3A642
LinkDB All DBs
Position
complement(1123240..1125807)
Genome map
AA seq 855 aa AA seqDB search
MQPLKVFSVVPKLPEGLEGLWELAYNLWFSWNEEIAALFSQIDQQLWIESYRNPVWFLNH
VPQRALETLAQDALYKSRLREAVARQRQYLSRPAYTLKGDEGGEGIRVVYFSLEYGISLC
LPIYSGGLGILAGDHLKSASDLNVPLAAIGIAYQQGYFRQYMTPDGWQQERYPNYDFEQM
PMRPALTPDGQPAVVHLDIGDRPLKARIWRVDVGRVPLYLLDTNIAENPPDFRQITERLY
GGNNEMRLWQEMLIGIGGIKALQVLGISPKVIHMNEGHSAFAGLERVRLFMKEHGLSFEA
AVEVAAAGSIFTTHTPVPAGNDRFAPDLMARYFEPYASDMGLAFKVFMALGREVPHDDSE
PFCMPVLALRLSRFNNGVSKLHGRVSRNMWKRVWNQFPVEDVPIGALTNGVHAPTWVAPD
IGLLYDRYLGSNWREDPDSSRAWSLVDTISDAELWRTHERLRARLVDFARMRLHRQLAAQ
GARRQDIQMAEEVLNPEALTIGFARRFATYKRANLLLQERDRLIRLVTSTDRPVQFIFAG
KAHPQDQEGKQLMKELIALCRSRECRMSMVFLEDYDMEVASHLVSGCDIWLNNPRRPLEA
CGTSGMKAMLNGVMQFSTLDGWWDEAYRPDNSLGWAIGKGEEYEDPDYQDFVEVQTLYNI
LENDIIPDFYDRGHGGIPRTWVRRMKAALRELAPAFNSHRMVMDYAGTAYAPALHNFNEL
TQRDFAPARELSEWRMDIMTKWSMLQIRNVRAQQADTLHVGDALTVEAEILLNGIDPGHI
RAEIYAGHLNQDNSFAHRELSPMQHVGQTDDGWQVFRGTTAPAEAGRYGFTVRVCPTHPR
LADPHSLGLIRWAGV
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgcagccactcaaggtgttcagcgtcgtccccaagctccccgaaggtctcgaaggtctg
tgggaactcgcctacaacctctggttctcatggaacgaggagattgcggcactcttctcg
caaatcgaccagcaactctggatagagagctaccgcaacccggtgtggtttctgaaccat
gtcccgcagagggcccttgagacgctggcacaggacgccctctacaaatcccgcctgcgt
gaggccgtggcacggcagcggcagtatctttcgcgtcccgcatacaccctcaagggtgat
gaagggggcgaaggcatccgcgtcgtctacttcagcctcgaatacggcatctcgctctgc
cttcccatctattcgggcggactcggcattctcgctggcgaccacctcaagtcggccagc
gacctcaacgtcccccttgccgccatcggcatcgcctaccagcagggctacttccggcag
tacatgacgcccgacggctggcagcaggaacgctaccccaactacgatttcgaacagatg
ccgatgcgccccgccctcacccccgacgggcagcccgccgtggtgcacctcgacatcggc
gaccgcccgctcaaggcccgcatatggcgcgtggacgtggggcgtgtgccactttacctg
ctcgacaccaacatcgccgagaacccgccggacttccggcaaatcaccgaacgcctgtac
ggtggcaacaacgagatgcgcctctggcaggagatgctcatcggcatcggcggcatcaag
gcgttgcaggtgctaggcatctcgcccaaggtcatccacatgaacgaaggacactcggcc
ttcgccggtcttgagcgcgtccgcctgttcatgaaggagcacggactctcgttcgaggcc
gccgtcgaggtcgccgccgcgggttccatcttcaccacccacaccccggtgcccgcaggg
aacgaccgtttcgcccccgacctcatggcccgctatttcgaaccgtacgccagcgacatg
gggctcgccttcaaggtgttcatggcactgggtcgcgaggtgccgcatgacgacagcgaa
ccgttctgcatgcccgtgctggccctgcgcctgtcacggttcaacaatggcgtctccaaa
ctgcacgggcgcgtgtcgcgcaacatgtggaagcgcgtgtggaaccagttccccgtcgag
gatgtgcccataggagccctcaccaacggtgtgcacgcccccacatgggtggccccggac
atcggcctgctctatgacaggtaccttggctcgaactggcgcgaagaccccgacagcagc
cgcgcgtggagccttgtcgacaccatctccgatgcggaactctggcgcacccatgagcgg
ctgcgcgcccgcctcgtcgacttcgcccgcatgagactgcacaggcagctggcggcacag
ggggcacgcaggcaggacatccagatggccgaagaggtgctgaaccccgaggccctcacc
atcggcttcgcgcggcggttcgccacctacaagcgcgccaacctgctgttgcaggaacgt
gacaggctcatacgccttgtcaccagcaccgaccgtccggtgcagttcatattcgcgggc
aaggcccatccgcaggaccaggaaggcaaacaactcatgaaggagctcatcgcgctgtgc
cgcagccgcgaatgccgcatgagcatggtctttctggaagactacgacatggaggtggcc
tcgcacctcgtctccggctgcgacatctggctcaacaacccgcgccgcccgctcgaggcc
tgcggcaccagcggcatgaaggccatgctcaacggcgtcatgcagttttcgacactcgat
ggctggtgggacgaggcatacagacccgacaacagcctcggctgggccatcggcaaggga
gaggaatacgaagaccccgactatcaggacttcgtcgaggtgcagacgctctacaacatc
ctcgagaacgacatcatccccgacttctacgaccgcgggcacggcggcattccacgcaca
tgggtacggcgcatgaaggctgccctgcgtgaactggccccggccttcaactcgcaccgc
atggtcatggactatgccggcaccgcctatgccccggccctgcacaacttcaatgaactg
acgcagcgcgacttcgccccggcacgcgaactctccgaatggcgcatggacatcatgacc
aagtggagcatgctgcagatacgcaacgtccgcgcacagcaggccgataccctgcacgtg
ggcgacgccctcaccgtggaagcggagatactcctgaacggcatcgaccccgggcacatc
cgggccgagatttacgccggacatctcaatcaggacaacagcttcgcccatcgtgaactc
agcccgatgcagcacgtgggacagaccgacgacggctggcaggtcttccggggcactacg
gccccggccgaggcgggccgctacgggttcaccgtgcgtgtgtgccccacgcacccccgg
ctggccgacccgcactcgctgggcctcatccgctgggcgggggtctag

DBGET integrated database retrieval system