KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0592Help
Entry
DvMF_0592         CDS       T00816                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 Sugar_tr MFS_1_like MFS_2 LacY_symp TRI12
Motif
Other DBs
NCBI-ProteinID: ACL07549
UniProt: B8DKX0
LinkDB All DBs
Position
702914..704065
Genome map
AA seq 383 aa AA seqDB search
MHPLLRDRNLHTIFGITLTVIMGVSSIMPALPLMARELDIPLASVGLVLTAFTLPGIVLA
PIAGVLADRLGRKRVLLPAMALFALGGSACFFARDLSTLLACRFVQGFGAAPLGVLYTTL
IGDLYEDSDRVRAMGYNAGVLSLGTAIFPAVGGLLAELGWNVPFLLPLAVLPLMLAAARL
RLPASRATQTLGEYFRSTLRIALSPRALVLFGLSLLTFVQLYGPMVTFFPVLADTRFHAA
PSRIGAIFAVSSLGTAMIASQLGRLSERFPARRLIMLSHVLYAAAMLLLPLMPGLWWLLG
PVLCFGMAQGLNLPNLSTMMTSLAPTQQRAAIMAVNGTLLRLGQTLAPLLFGLLYAGGDL
PAVFAGGAVVSCLMLALAAWRLH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctgctgcgcgacagaaacctgcacaccatattcgggatcacccttacagtg
atcatgggcgtttccagcatcatgcccgccctgccgctgatggcgcgcgaactggacata
cccctggcctctgtggggctggtgctgaccgccttcaccctgcccggcatcgtgctggcc
cccatcgcgggcgtgctggccgaccggctgggccgcaagcgcgtgctgctgcccgccatg
gccctgttcgccctcgggggctcggcctgcttcttcgcgcgtgacctttccaccctgctg
gcctgccgcttcgtgcaggggtttggcgcggccccgctgggcgtgctgtacaccaccctt
atcggcgacctgtacgaagacagcgaccgggtacgggccatggggtacaacgccggcgtg
ctcagtctgggcacggccatctttcccgccgtgggcggactgctggcggaacttggctgg
aacgtccccttcctgctgcccctggccgtgctgccgctgatgctggccgccgcgcgcctg
cgtctgcccgcctcgcgcgccacgcagaccctgggtgaatatttccgctccaccctgcgc
attgcgctgtcgccgcgcgcactggtgctgttcggactttccctgcttaccttcgtgcaa
ttgtacggccccatggtcaccttctttccggtgctggcggacacccgcttccacgccgcg
ccttcgcgcatcggcgccatctttgccgtgtcctccctgggcacggccatgatcgcctcg
caactggggcgcctgtcggaacgctttcccgcccggcggctgatcatgctcagccatgtc
ctctacgccgccgccatgctgcttctgccgctgatgcccggcctgtggtggctgctgggg
ccggtgctgtgcttcggcatggcccaggggctgaacctgcccaacctgtccaccatgatg
acctcgctggcccccacccagcaacgcgccgccatcatggccgtcaacggcaccctgctg
cgtctgggccagaccctggccccgctgctgttcggcctgctctacgccgggggtgacctg
cccgccgtgttcgcgggcggggccgtcgtcagttgcctgatgctcgcgctggcggcgtgg
cggctgcactag

DBGET integrated database retrieval system