KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1986Help
Entry
DvMF_1986         CDS       T00816                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Brite
Enzymes [BR:dvm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DvMF_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACL08929
UniProt: B8DQ65
LinkDB All DBs
Position
2458170..2458886
Genome map
AA seq 238 aa AA seqDB search
MPSSFTRRCFMSLCASAAVVAAGTRLLGPTVAHAADAPDAFPMPPLPYPENGLEPAISAR
TISFHYGKHTAAYYGNLNKAVAGTPMATMKLEDVIKSVAGDPAKAGLFNNAAQSWNHTFY
WAGMKPGGGGTPPAKVADALSAAFGSVDACVTQLSDAAKTQFASGWAWLAKGRENGKDVL
KVLKTGNAETPITQGYTPILTIDVWEHAYYLDYQNKRPDYVQAFFDKLVNWDEVAKRL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccagcttcacccgccgctgcttcatgtccctgtgcgcctcggcagccgtcgtg
gccgccggcacccgcctgctgggccccaccgttgcccatgccgccgacgcccccgacgcc
tttcccatgccgccgctgccctaccccgaaaacgggctggagcccgccatcagcgcgcgc
accatctcgttccattacggcaagcacaccgccgcctactacggcaacctgaacaaggcc
gtggcaggcacccccatggccaccatgaagctggaagacgtcatcaagtccgtggcgggt
gatccggccaaggccgggctgttcaacaacgccgcccagtcctggaaccacaccttctac
tgggccggcatgaagcccggcggcggcggcacgccccccgccaaggtggccgacgccctg
tccgccgccttcggctccgtggacgcctgcgtcacccaactttccgacgccgccaaaacc
cagttcgccagcggctgggcctggctggccaagggccgcgaaaacggcaaggacgtgctg
aaggtgctgaaaaccggcaacgccgaaacccccatcacccaaggctatacccccatcctc
accatcgacgtatgggaacacgcctactacctggactaccagaacaagcgccccgactac
gtccaggccttcttcgacaagctggtgaactgggacgaagtggccaagcggttgtag

DBGET integrated database retrieval system