KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2513Help
Entry
DvMF_2513         CDS       T00816                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Brite
KEGG Orthology (KO) [BR:dvm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dvm03012]
    DvMF_2513
   03029 Mitochondrial biogenesis [BR:dvm03029]
    DvMF_2513
Translation factors [BR:dvm03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    DvMF_2513
 Prokaryotic type
   DvMF_2513
Mitochondrial biogenesis [BR:dvm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DvMF_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2 GTP_EFTU IF2_N MMR_HSR1 GTP_EFTU_D2 Arf Ras RsgA_GTPase FeoB_N SRPRB Roc PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ACL09452
UniProt: B8DN12
LinkDB All DBs
Position
complement(3167905..3171144)
Genome map
AA seq 1079 aa AA seqDB search
MTDDKTRVKDLSTELGVSTKDLLHTLRDLDIPAKSVMTTLTADEVSRVRERHQGQTAEAG
VDRKVVQPGVIVRRRRRDGEEGEAPVRRRADEGEAASGIADAEAPAAKAEAPVPPAADER
PARAARAEAPAAPEARPATPAARIIRRHDEPAPVAEAPAEPVQVAPVAPAAPVTPAPASA
DKPADVQVEAAPAVAAQQAEKPATPTARIIRPARPDASAMPDATPQPSILPPVAADAAPR
GEGVDGDEDDADGNRRRKKKRTPDAPGPQVRVISRPDPSAPAPRPYPQGDRTDRGDRPAY
GDRQGYQPRSGGPGGDRPSYGGDRQGYAPRPGGPGGPGGDRPGYAPRPGGPGGDRPGYAP
RPGGPGGDRPGYGPRPGGPGGPGGPGGDRPGGYRPGGPGGPRPGGPGGPGYGPRPGGPGG
PGGPGMGQPPAGGDEGQSKKKRLKGRRTVDFQPGADRTTRGREDDDFPRGGARRGKGRKG
RDMKVATATQPLKAAKRKIKVEEAIRVADMAHQMGLKSTEIIKVLFGLGVMATINQSLDI
ETATLVASEFGYEVEKVGFSEDDYLIPKEEDTPETLQHRPPVVTIMGHVDHGKTSLLDAI
RKTNVTMGEAGGITQHIGAYHVTTKKGEIVFLDTPGHEAFTAMRARGAQVTDIVVLVVAA
DDGVMEQTREAVNHSKAAGVPIMVAVNKMDKEGANPERVQRELAEMGLVSEAWGGDTVFS
HVSAKTRQGLDELLELLALQAEILELKANPDKPARGHIVEAKLDKGRGPVATVLIQEGTL
KQGDTFVCGVFSGRVRAMFNDQGKKVKEAGPAMPVEVQGFEGVPEAGEEFVCVTDEKLAR
RIAETRAVKQREKELARESKVTLETFLSRRVDDQEALVLNLVVKSDVQGSLEAISEALRK
LSTEKVRINIIHGGAGAISESDILLASASDAIIIGFNVRPTAKVKDIAEQENVDIRFYDI
IYKLVDEVKSAMEGMLAPVQREVYLGQVEVRQTFGVPKVGTIAGCHVADGKITRNAGVRL
LRDGVVVYTGKITSLKRFKDDMKEVMKGYECGVGLENFNDIKIGDIIEAFEMVEEAATL
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgacaagaccagggtgaaggacctgtccacggagctgggcgtgtccaccaaa
gatctgctccacacgctgcgcgacctcgacatcccggccaagagcgtgatgaccacgctt
accgccgacgaggtcagccgcgtgcgcgaacgccatcagggccagaccgccgaagcgggc
gttgaccgcaaggtggttcagcccggcgtcatcgtgcgccgccgccgccgcgacggcgaa
gagggcgaagcccccgtgcgtcgtcgtgccgatgagggcgaagccgcatccggcattgcc
gacgccgaagcgcccgccgccaaggccgaagcgcccgtgccgcccgcagctgacgaacgg
cccgcccgtgccgcccgcgccgaagcccccgcggcgcccgaggcacgccctgccacgccc
gccgcgcgcatcatccgccgccacgacgagcccgcaccggtcgcggaagcaccggcagag
cccgtacaggtggcccccgtggccccggcagcccccgtgactcccgcgcccgccagtgcg
gacaagcccgccgatgtgcaggtggaagccgccccggcggttgctgcccagcaggccgaa
aagcccgccacgcccaccgcgcgcatcatccgcccggcccggcccgacgcttcggccatg
cccgacgccaccccccagccctccatcctgccccccgtggcggctgacgccgcaccgcgc
ggtgaaggcgtggatggcgacgaggacgacgccgacggcaaccgccgcaggaaaaagaag
cgcacgcccgacgcgcccggaccccaggtccgcgtcatttcccgtcccgatccttccgct
ccggcgccgcgcccctacccgcaaggcgaccgcacggacaggggcgaccgccccgcctac
ggcgaccggcagggctaccagccccgctccggcggccccggcggcgatcgtcccagctac
ggtggcgaccggcagggctatgcgccccgccccggcggccctggtggccccggcggtgac
cgtcccggttacgcgccccgccccggcggccctggcggtgatcggcccggctacgcccct
cgtcccggcgggcccggtggtgaccgtcccggttacggtccccgtcccggtggtccgggt
ggtcccggcggccccggtggtgatcgccccggcggttatcgtccgggtggtcccggcggt
ccccgtcccggtggccccggcggccccggctacggtccccgtcctggtggtcccggcggc
cccggcggccccggcatgggccagcccccggcgggcggcgacgaaggccagagcaagaag
aagcgcctgaagggccgccgcacggtggacttccagcccggtgccgatcgcaccacgcgt
ggccgcgaggacgacgatttcccgcgtggcggcgcccgccgcggcaaggggcgcaagggc
cgcgacatgaaggtcgccaccgccacccagccgctgaaggcagccaagcgcaagatcaag
gtcgaggaagccatccgcgtggccgacatggcccaccagatgggcctgaagtccaccgaa
atcatcaaggtgctgttcggccttggtgtcatggcgaccatcaaccagtcgctggacatc
gaaaccgccaccctggtggcctcggaattcggctacgaagtggaaaaggtgggcttctcg
gaagacgactacctgatcccaaaggaagaagacacgcccgagaccttgcaacatcggcct
cccgtggtcaccatcatgggccacgtcgaccatggcaagacctcgctgctcgacgccatc
cgcaagaccaacgtcaccatgggcgaagcgggcggcatcacccagcacatcggcgcgtac
cacgtgaccaccaagaagggtgagatcgtgttcctcgacacgcccggccacgaagcgttc
actgccatgcgtgcccgaggcgcgcaggtgaccgacatcgtcgtgcttgtggtggccgcc
gacgacggcgtcatggagcagacccgcgaagcggtgaaccactccaaggccgctggcgtg
cccatcatggttgccgtcaacaagatggacaaggaaggcgccaacccggaacgcgtgcag
cgcgaactggcggaaatgggcctggtgtccgaagcctggggcggcgataccgtgttcagc
catgtgtcggccaagacccgccagggcctggacgaactgctggaactgctggccctgcaa
gccgaaatccttgagctgaaggccaaccccgacaagcccgcccgtggccacatcgtggag
gccaagctggacaagggccgtggccccgtggccaccgtgctgatccaggaaggcaccctg
aagcagggcgacacctttgtgtgcggcgtgttcagtggccgcgtgcgcgccatgttcaac
gaccagggcaagaaggtgaaggaagccggccccgccatgccggtggaagtgcagggcttc
gagggcgtgcccgaagcgggcgaggaattcgtgtgcgtgacggacgaaaagctcgcccgc
cgcatcgcggaaacccgcgccgtgaagcagcgcgaaaaggaactggcccgcgaatccaag
gttaccctggaaacgttcctgtcccgtcgcgtcgacgaccaggaagccctggtgctcaac
cttgtcgtcaagtccgacgtgcagggctcgctggaagccatctccgaggcgctgcgcaag
ctcagcaccgaaaaggtgcgcatcaacatcatccacggcggtgccggggccatctccgaa
tccgacatcctgctggcatcggcctccgacgccatcatcatcggcttcaacgtccgcccg
accgccaaggtcaaggacatcgccgagcaggaaaacgtggacatccgcttctacgacatc
atctacaagcttgtggatgaagtgaagagcgccatggaaggcatgctcgccccggtgcag
cgcgaagtgtacctgggccaggtggaagtgcggcagaccttcggcgtgcccaaggtgggc
accattgcgggctgccacgttgcggacggcaagatcacccgcaacgccggcgtgcgcctg
ctgcgcgacggcgtggtggtctacaccggcaagatcacgtcgctcaagcgcttcaaggac
gacatgaaggaagtcatgaagggctatgaatgcggcgtgggccttgaaaacttcaacgac
atcaagataggcgacatcatcgaagccttcgagatggtcgaagaagccgccacgctgtaa

DBGET integrated database retrieval system