KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_3147Help
Entry
DvMF_3147         CDS       T00816                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00500  Starch and sucrose metabolism
dvm01100  Metabolic pathways
dvm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DvMF_3147
Enzymes [BR:dvm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     DvMF_3147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: ACL10083
UniProt: B8DNE1
LinkDB All DBs
Position
complement(3970413..3972983)
Genome map
AA seq 856 aa AA seqDB search
MQPLKVFSVIPKLPEGLEGLWELAYNLWFSWNSDMETIFSQMDQRLWQESYRNPVWFLNH
VPQRTLEELSRDAFFKERLADAVEQLRQYVGRPSPHKFEGVATGTPAVAYFSLEFGLALC
LPIYSGGLGILAGDHLKSASDLNVPLVGIGIAYQQGYFRQYMTPDGWQQERYPVYDFEQM
PMRPALTPDGQPAVVRLDVGDRPLAARIWQVAVGRVTLYLLDTNLPENPPDFRQITERLY
GGNIEMRLWQEILLGIGGIKALKVLGIDPKVIHMNEGHSAFAGLERVRLYMKEHGLPFEA
ATEVAASGSIFTTHTPVPAGNDRFAPDLMHRYFESYARDMGLAFKVFMALGREAPHDDAE
PFCMTVLALRLSRANNGVSTLHGRVSRNMWKQVWHQFPVEDVPIGALTNGVHAPTWVAQD
IGMLYDRYLGSNWREDPDCARAWSQVDTISDAEFWRTHERLRARLVDFVRERLRRQLAAQ
GARRQDIQAAEEVLNPEALTIGFARRFATYKRANLLLQDRERLERILGDRERPVQFIIAG
KAHPQDQDGKQLIKDLIVFSRSQGANMSVVFLEDYDMEVASYLVTGCDVWLNNPRRPLEA
CGTSGMKAMLNGVVQFSTLDGWWDEAYRPDNSLGWAIGKGEEYDDPDYQDFVEMQTLYNI
LENDIIPEFYDRGRGGLPRSWIRRMKAALKELAPRYNSHRMVLDYLGTAYSPAHGYYMRL
ARDGFVPARELSEWRMDMMTKWSAVQIRNVRSRVEDTLHVGDSLRVEAELYLDDIAAEHV
LVQLYAGPLGQDGSFAQRQLTVMTPEGERRDGWQTFSGSTRPAEAGRFGFTVRAAPVHPL
LADPHSLGLIRWAAPA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgctcaaggtcttcagcgtcatccccaagctgcccgaagggctcgaagggttg
tgggaactggcctacaacctctggttctcgtggaacagcgacatggagaccatcttctcg
cagatggaccagcgcctgtggcaggaaagctaccgcaatccggtatggttcctgaaccac
gtgccccagcgtacccttgaggaactctctcgcgacgcgttcttcaaggaacgattggcc
gatgccgtggaacagctgcgccagtacgtgggcaggccgtcgccgcacaagttcgagggc
gtggccaccggcacgcccgccgtggcctatttcagcctggaattcggcctggccctgtgc
ctgccgatctattccggcggcctcggcattctggcgggcgaccacctgaagtcggccagc
gacctcaacgtgccgctggtgggcatcggcattgcctatcagcagggatatttccgccag
tacatgacccccgacggctggcagcaggaacgctacccggtctacgatttcgagcagatg
cccatgcgccctgccctgacgcccgacggccagcccgccgtggtgcggctggacgtgggc
gaccgcccccttgctgcgcgcatctggcaggtggccgtgggccgcgtgaccctgtatctg
ctggacaccaacctgccggaaaacccgcccgacttccgccagatcaccgaacggctgtac
ggcggcaacatcgaaatgcgcctgtggcaggaaatcctgctgggcatcggcggcatcaag
gcgctgaaggtgctgggcatcgaccccaaggtcatccacatgaacgaggggcattccgcc
ttcgcggggcttgagcgggtgcggctgtacatgaaggagcacgggctgcccttcgaggcc
gcaacggaggtggccgcctccggctccatcttcaccacgcacaccccggtgcccgcgggc
aacgaccgctttgccccggacctgatgcaccgctacttcgaatcctacgcccgcgacatg
gggctggccttcaaggtgttcatggcccttgggcgagaagccccccacgacgacgcggaa
cccttctgcatgaccgtgctggccctgcgcctgtcgcgcgccaacaacggcgtgtccacc
ctgcatggccgcgtgtcgcgcaacatgtggaagcaggtgtggcaccagttcccggtggag
gacgtgcccatcggcgcgctgaccaacggggtgcacgcgcccacctgggtggcccaggac
atcggcatgctgtacgaccggtaccttggctccaactggcgcgaggacccggactgcgcc
cgcgcctggagccaggtggacaccatttccgacgccgagttctggcgcacccacgaacgg
ctgcgcgcccggctggtggacttcgtgcgcgagcggctgcgccgccagctggccgcgcag
ggggcgcggcggcaggacatccaggccgccgaagaggtactgaaccccgaggccctgacc
atcggttttgcccggcgcttcgccacctacaagcgggccaacctgctgttgcaggaccgc
gaacgactggaacgcatcctgggcgaccgcgaacgcccggtgcagttcatcatcgcgggc
aaggcgcacccccaggaccaggacggcaaacagctgatcaaggatctgatcgtcttcagc
cgttcgcagggcgcgaacatgagcgtggtctttctggaagactacgacatggaggtggcc
tcgtacctggtcacgggctgcgacgtgtggctgaacaacccccgccgcccgctggaggcc
tgcggcaccagcggcatgaaggccatgctcaacggcgtggtgcagttctccaccctggat
ggctggtgggacgaggcctacaggccggacaacagcctgggctgggccatcggcaagggc
gaggaatacgacgacccggactaccaggacttcgtggagatgcagaccctctacaacatc
ctggaaaacgacatcatcccggaattctacgaccgaggccggggcggcctgccccgctcg
tggatacgccgcatgaaggccgcgctgaaggaactggccccccgctacaactcgcaccgc
atggtgctggactatctgggcacggcctattccccggcccacggctactacatgcgcctc
gcgcgcgacggcttcgtcccggcgcgcgagctttccgaatggcgcatggacatgatgacc
aagtggagcgcggtacagatccgcaacgtgcgcagccgggtggaggacaccctgcacgtg
ggcgattcgttgcgggtggaggcggaactgtacctcgacgacatcgcggcggaacacgtg
ctcgtccagttgtacgccgggccgctggggcaggacggctcctttgcccagcgccagctg
acggtcatgacccccgagggcgaacgacgcgacggctggcagaccttcagcggcagcacc
cgcccggcggaggccggacgcttcggctttaccgtgcgggccgcaccggtgcacccgctg
ctggcagacccgcattcgctgggcctcatccgctgggccgcgcccgcatag

DBGET integrated database retrieval system