KEGG   Desulfovibrio vulgaris Hildenborough: DVU2349Help
Entry
DVU2349           CDS       T00171                                 

Definition
(RefSeq) carbohydrate phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00500  Starch and sucrose metabolism
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DVU2349
Enzymes [BR:dvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     DVU2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glycos_transf_1 DUF3416 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 2795523
NCBI-ProteinID: YP_011562
UniProt: Q729K1
LinkDB All DBs
Position
2442630..2445197
Genome map
AA seq 855 aa AA seqDB search
MQPLKVFSVVPKLPEGLEGLWELAYNLWFSWNEEIAALFSQIDQQLWIESYRNPVWFLNH
VPQRALETLAQDALYKSRLREAVARQRQYLSRPAYTLKGDEGGEGIRVVYFSLEYGISLC
LPIYSGGLGILAGDHLKSASDLNVPLAAIGIAYQQGYFRQYMTPDGWQQERYPNYDFEQM
PMRPALTPDGQPAVVHLDIGDRPLKARIWRVDVGRVPLYLLDTNIAENPPDFRQITERLY
GGNNEMRLWQEMLIGIGGIKALQVLGISPKVIHMNEGHSAFAGLERVRLFMKEHGLSFEA
AVEVAAAGSIFTTHTPVPAGNDRFAPDLMARYFEPYASDMGLAFKVFMALGREVPHDDSE
PFCMPVLALRLSRFNNGVSKLHGRVSRNMWKRVWNQFPVEDVPIGALTNGVHAPTWVAPD
IGLLYDRYLGSNWREDPDSSRAWSLVDTISDAELWRTHERLRARLVDFARMRLHRQLAAQ
GARRQDIQMAEEVLNPEALTIGFARRFATYKRANLLLQERDRLIRLVTSTDRPVQFIFAG
KAHPQDQEGKQLMKELIALCRSRECRMSMVFLEDYDMEVASHLVSGCDIWLNNPRRPLEA
CGTSGMKAMLNGVMQFSTLDGWWDEAYRPDNSLGWAIGKGEEYEDPDYQDFVEVQTLYNI
LENDIIPDFYDRGHGGIPRTWVRRMKAALRELAPAFNSHRMVMDYAGTAYAPALHNFNEL
TQRDFAPARELSEWRMDIMTKWSMLQIRNVRAQQADTLHVGDALTVEAEILLNGIDPGHI
RAEIYAGHLNQDNSFAHRELSPMQHVGQTDDGWQVFRGTTAPAEAGRYGFTVRVCPTHPR
LADPHSLGLIRWAGV
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgcagccactcaaggtgttcagcgtcgtcccgaagctccccgaaggtctcgaaggtctg
tgggaactcgcctacaacctctggttctcatggaacgaggagattgcggcactcttctcg
caaatcgaccagcaactctggatagagagctaccgcaacccggtgtggtttctgaaccat
gtcccgcagagggcccttgagacgctggcacaggacgccctctacaagtcccgcctgcgt
gaggccgtggcacggcagcggcagtatctttcgcgtcccgcatacaccctcaagggtgat
gaagggggcgaaggcatccgcgtcgtctacttcagcctcgaatacggcatctcgctctgc
cttcccatctattcgggcggactcggcattctcgctggcgaccacctcaagtcggccagc
gacctcaacgtcccccttgccgccatcggcatcgcctaccagcagggctacttccggcag
tacatgacgcccgacggctggcagcaggaacgctaccccaactacgacttcgaacagatg
cccatgcgccccgccctcacccccgacgggcagcccgccgtggtgcacctcgacatcggc
gaccgcccgctcaaggcccgcatatggcgcgtggacgtggggcgtgtgccactttacctg
ctcgacaccaatatcgccgagaacccgccggacttccggcaaatcaccgaacgcctgtac
ggtggcaacaacgagatgcgcctctggcaggagatgctcatcggcatcggcggcatcaag
gcgttgcaggtgctcggcatctcgcccaaggtcatccacatgaacgaaggacactcggcc
ttcgccggtcttgagcgcgtccgcctgttcatgaaggagcacggactctcgttcgaggcc
gccgtcgaggtcgccgccgcgggttccatcttcaccacccacaccccggtgcccgcaggg
aacgaccgtttcgcccccgacctcatggcccgctatttcgaaccgtacgccagcgacatg
gggctcgccttcaaggtgttcatggcactgggccgcgaggtgccgcatgacgacagcgaa
ccgttctgcatgcccgtgctggccctgcgcctgtcacggttcaacaatggcgtctccaaa
ctgcacgggcgcgtgtcgcgcaacatgtggaagcgcgtgtggaaccagttccccgtcgag
gatgtgcccataggagccctcaccaacggtgtgcacgcccccacatgggtggccccggac
atcggcctgctctatgacaggtaccttggctcgaactggcgcgaagaccccgacagcagc
cgcgcgtggagccttgtcgataccatctccgatgcggaactctggcgcacccatgagcgg
ctgcgcgcccgcctcgtcgacttcgcccgcatgagactgcacaggcagctggcggcacag
ggggcacgcaggcaggacatccagatggccgaagaggtgctgaaccccgaggccctcacc
atcggcttcgcgcggcggttcgccacctacaagcgcgccaacctgctgttgcaggaacgt
gacaggctcatacgccttgtcaccagcaccgaccgtccggtgcagttcatattcgcgggc
aaggcccatccgcaggaccaggaaggcaaacaactcatgaaggagctcatcgcgctgtgc
cgcagccgcgaatgccgcatgagcatggtctttctggaagactacgacatggaggtggcc
tcgcacctcgtctccggctgcgacatctggctcaacaacccgcgccgcccgctcgaggcc
tgcggcaccagcggcatgaaggccatgctcaacggcgtcatgcagttttcgacactcgat
ggctggtgggacgaggcatacagacccgacaacagcctcggctgggccatcggcaaggga
gaggaatacgaagaccccgactatcaggacttcgtcgaggtgcagacgctctacaacatc
ctcgagaacgacatcatccccgacttctacgaccgcgggcacggcggcattccgcgcaca
tgggtacggcgcatgaaggctgccctgcgtgaactggccccggccttcaactcgcaccgc
atggtcatggactatgccggcaccgcctatgccccggccctgcacaacttcaatgaactg
acgcagcgcgacttcgccccggcacgcgaactctccgaatggcgcatggacatcatgacc
aagtggagcatgctgcagatacgcaacgtccgcgcacagcaggccgataccctgcacgtg
ggcgacgccctcaccgtggaagcggagatactcctgaacggcatcgaccccgggcacatc
cgggccgagatttacgccggacatctcaatcaggacaacagcttcgcccatcgtgaactc
agcccgatgcagcacgtgggacagaccgacgacggctggcaggtcttccggggcactacg
gccccggccgaggcgggccgctacgggttcaccgtgcgtgtgtgccccacgcatccccgg
ctggccgacccgcactcgctgggcctcatccgctgggcgggggtctag

DBGET integrated database retrieval system