KEGG   Desulfovibrio vulgaris Hildenborough: DVU2368Help
Entry
DVU2368           CDS       T00171                                 

Gene name
fabZ
Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00061  Fatty acid biosynthesis
dvu00780  Biotin metabolism
dvu01100  Metabolic pathways
dvu01212  Fatty acid metabolism
Module
dvu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DVU2368 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DVU2368 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dvu01004]
    DVU2368 (fabZ)
Enzymes [BR:dvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DVU2368 (fabZ)
Lipid biosynthesis proteins [BR:dvu01004]
 Fatty acid synthase
  Component type
   DVU2368 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas PS-DH AfsA
Motif
Other DBs
NCBI-GeneID: 2796527
NCBI-ProteinID: YP_011581
UniProt: P61452
LinkDB All DBs
Position
complement(2464274..2464738)
Genome map
AA seq 154 aa AA seqDB search
MIDPAQSILDIRQILGLLPHRYPFLLVDRVVEYVPGDYIKAYKNVTMNEPFFQGHFPGVP
VMPGVLIMEALAQAGGILVVKSTDTAVEDKLFLFTGIESVRFRKPVYPGDKLELHCRLLK
HKLKLWKMEGRAYVDGKLAAEAVMTAAVTNREDM
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacccggcgcagagcattcttgatatccgtcagatactggggctgttgccccac
cgttatcccttcctgctcgtcgaccgtgtggtcgaatacgttccgggcgactacatcaag
gcctacaagaacgtcaccatgaacgagcccttctttcaggggcatttccccggcgtgccc
gtcatgcccggtgtgctcatcatggaagcgttggcacaggccggtggcattctcgtggtc
aagagcaccgacacagccgtcgaggacaagctctttctcttcacgggcatcgagtcggtg
cgtttccgcaagccggtctaccccggcgacaagctggaattgcactgccgcctgctcaag
cacaagctcaagctgtggaagatggaagggcgtgcctacgtcgacggcaaacttgccgcc
gaagccgtgatgaccgccgccgtgaccaacagggaggacatgtga

DBGET integrated database retrieval system