KEGG   Drosophila willistoni: 26530149Help
Entry
26530149          CDS       T01067                                 

Definition
(RefSeq) anionic trypsin-1 isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dwi  Drosophila willistoni
Pathway
dwi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    26530149
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dwi01002]
    26530149
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dwi04147]
    26530149
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     26530149
Peptidases [BR:dwi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   26530149
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   26530149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Pico_P2A DUF1986
Motif
Other DBs
NCBI-GeneID: 26530149
NCBI-ProteinID: XP_023030535
LinkDB All DBs
Position
Unknown
AA seq 295 aa AA seqDB search
MYIDLILYNYLLLIGQVWCSSSNNNHSGRQILKGKGIFALKPVDLPLKTSVVSLRSRTAE
AYFGDNHFCTGCLINDFFVITSGKCVTSRGKVPRRPRELVVVSGSLSRLNQTRETEKLPV
SFAAVHPNYIMFNTNDIALLKLKDPVNENFQETDPAPQALSRPPYGSKCIVMGWGRKFAN
GPLVSNLTMLEVQLITPAQCRRFIPEMTDEMLCTVSRNNTLPVGPCPGDTGGPLFCNDAL
IGIVSYTMGCSRVNFPTVYTSVFYHQLWIEDLLDRGGQQRIKLAIGMLIWSYMMT
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtatatagatttgattctctacaattatctactactaattggtcaagtctggtgcagc
agcagcaacaacaaccattcaggacgacaaatactaaaaggcaaggggatattcgcttta
aaacctgtcgatttaccgttgaaaacttctgtggtctctctacgttcacgtaccgctgag
gcctattttggggataatcatttttgcacaggttgcttaataaatgatttctttgttata
acatcgggaaagtgtgtaacaagtcggggtaaagttccaagacgaccacgtgaactagtt
gttgtatctggatcactgagtcgtttgaatcaaactcgtgaaacggaaaagttaccggtt
agctttgcggcagttcatccaaattatatcatgttcaatacaaatgatattgccttattg
aaattgaaagatccagtaaatgaaaactttcaagaaactgatcctgcgccacaagctcta
tcgcgaccgccctatggcagtaaatgcattgtaatgggctggggtagaaaatttgcgaat
ggacccttggtaagtaatttaaccatgttggaggtacaattgattacaccggctcaatgt
cgacgctttatacccgaaatgaccgacgaaatgttatgtacagtgtctcgtaataatact
ttaccagtgggaccttgcccaggagataccggaggaccgctcttttgtaatgatgcatta
attggcattgtgtcatataccatgggctgcagtcgtgtaaattttcccactgtatacaca
agtgttttttatcatcagctctggatagaggatttgctagatcgtggtggacaacaacgg
attaaactagccattggtatgctaatatggtcgtacatgatgacataa

DBGET integrated database retrieval system