KEGG   Drosophila willistoni: 6638396Help
Entry
6638396           CDS       T01067                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dwi  Drosophila willistoni
Pathway
dwi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    6638396
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     6638396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 EF-hand_8 EF-hand_9 EF-hand_5 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA HI0933_like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 6638396
NCBI-ProteinID: XP_002061310
FlyBase: FBgn0222793
UniProt: B4MJK7
LinkDB All DBs
Position
Unknown
AA seq 726 aa AA seqDB search
MSSRMFKFGVTAASACVGSVLASWSIDRWNSPHVVSNATQRPPKRKRTLPLREEQIKSLQ
SGEEFDVLIIGGGATGAGCALDSVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKA
ILGLDLEQYRMVKEALAERATMLESAPHLTHPLPIMLPVYTWWQVPYYWVGIKAYDLVAG
DRNVKSSYYLSKKDALELFPMLKKDKLCGAIVYYDGQQDDARMCLAVALTAARHGATVCN
HVEVKELLKKDDGSGKQVLCGAKVKDHISGKEFTVKAKCIVNAAGPFTDSIRKMDNPTVK
SICCPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWQRQTIAGTTDLPCDITHTPT
PTEDEIQFILSEIKNYLNADVEVRRGDVLSAWSGIRPLVSDPNKEDTQSLARNHIVHVSP
SNLITIAGGKWTTYRAMAEHTIDAAIKACNLKPERAEAVTAYLKIEGGQGWTPTMYIRLV
QDFGLECEVAQHLAKSYGDRAFAVSKMASLTGKRWPIIGNRIHPEFPYIDAEIRYGVREY
ACTAVDMIARRLRLAFLNVQAASEALPVIVDIMGEELKWSKDEKERQIKHATEFLANEMG
HTVNRTSKERIPIKLSKEEIQTYIKRFQIIDKDKKGYVSINDIRRALKSFGDADVSGEQL
HEILKEIDTNMNGQVELDEYLQMMSAIKTGDVAYSRFARMAELEEQKHEAANLKQKISVD
RSGGGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacgtatgtttaagttcggtgtaacagccgcaagtgcctgtgtgggttcagtg
ctggcctcctggtccattgatcgctggaactccccccatgtggtgagcaatgccactcaa
cgtccaccaaaacgtaagcgtactctacccctacgtgaggagcagatcaaatctctccaa
agtggtgaggaatttgatgtcctgatcattggtggcggtgccacaggtgctggctgtgcc
ttagattcggtaacaagaggtttaaagactgccctggtggagttggatgactttgccagt
ggtacatcttcgcgttccactaagcttatccatggtggtgtgcgttatctgcaaaaggct
atactcggcctagacttggagcagtatcgtatggttaaagaagctttggccgagcgtgcc
actatgctagagtcggcgccccatttgacccatccattgcccatcatgttgcccgtttat
acgtggtggcaagtgccctactactgggtgggcattaaggcctacgatctggtggctggt
gatcgcaatgtgaagagctcatattatctatccaagaaggatgccctcgagctgtttccc
atgttgaagaaggacaaattgtgcggtgctattgtctactatgatggacagcaggatgat
gcccgcatgtgtctggcggtggctttgacggctgctcgtcatggtgccactgtctgcaat
catgtggaggtcaaggaattgctcaaaaaggacgatggttcgggcaaacaagtgctctgt
ggcgccaaggtaaaggatcatatttctggcaaggaattcaccgtaaaggccaagtgtatt
gttaatgccgccggtccatttaccgattccattcgcaaaatggataatcccacggttaag
agcatctgctgccccagctcgggtgtgcatattgttttacccggctactatagtcccgat
cagatgggtctgctcgatccatcgacttccgatggtcgtgtcattttcttcctgccctgg
caacgtcaaacgattgcgggtacaaccgatttaccctgcgatattacccacactcccaca
cccaccgaagatgaaattcagttcattttgagcgaaatcaagaattatcttaatgccgat
gtggaagtgcgtcgcggtgatgtgttgtccgcctggagcggcatccgaccattggtatcg
gatcccaacaaggaagatacccagtctctggcccgtaatcacattgtccatgtgagtccc
tcaaatctcattaccattgctggcggtaaatggaccacctacagagccatggcagagcac
accatcgatgcggctattaaggcctgcaatctgaagcccgaacgtgctgaagctgttacc
gcttatttgaaaattgaaggcggacaaggttggacaccaaccatgtatattcgtctcgtc
caggactttggtctcgagtgtgaggttgcccagcacttggccaaatcgtatggtgatcgt
gctttcgccgtgtccaagatggcttccctgaccggcaaacgttggcccattattggcaat
cgcatccatcccgaattcccctacattgatgctgagatccgttacggtgttagggaatat
gcctgcacagctgtcgatatgattgctcgtcgtttgcgtcttgctttcctcaatgtccag
gcagcatccgaggctttgccggttattgttgatattatgggcgaggagttgaagtggtct
aaggatgagaaggagcgtcaaatcaaacatgccactgagtttttggccaacgaaatggga
catactgtcaatcgcacctccaaggaaagaatacccattaaactttcgaaagaggaaatt
cagacatatattaaacgtttccaaatcattgacaaggacaagaagggatacgtgtccatc
aatgatattcgtcgcgcactgaagagtttcggtgatgccgatgtctccggcgagcaattg
cacgagatacttaaagagatcgatacgaatatgaatggccaggtggaactcgatgaatat
cttcagatgatgtcggccattaagacgggcgatgtggcttattcccgatttgctcgcatg
gccgagctggaggagcagaaacatgaggcggcaaatcttaagcaaaagatcagtgtcgat
cgctctggtggcggcttgtaa

DBGET integrated database retrieval system